diff --git a/go.mod b/go.mod index 82b6747..c793547 100644 --- a/go.mod +++ b/go.mod @@ -6,10 +6,10 @@ require ( github.com/alecthomas/kingpin v2.2.6+incompatible github.com/gorilla/handlers v1.5.1 github.com/gorilla/mux v1.8.0 - github.com/hashicorp/consul/api v1.21.0 + github.com/hashicorp/consul/api v1.25.1 github.com/maxbrunsfeld/counterfeiter/v6 v6.5.0 github.com/onsi/ginkgo v1.16.5 - github.com/onsi/gomega v1.22.1 + github.com/onsi/gomega v1.27.10 github.com/pkg/errors v0.9.1 github.com/prometheus/client_golang v1.17.0 github.com/prometheus/client_model v0.4.1-0.20230718164431-9a2bf3000d16 @@ -22,33 +22,36 @@ require ( require ( github.com/alecthomas/template v0.0.0-20190718012654-fb15b899a751 // indirect github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 // indirect - github.com/armon/go-metrics v0.3.10 // indirect + github.com/armon/go-metrics v0.5.1 // indirect github.com/beorn7/perks v1.0.1 // indirect github.com/cespare/xxhash/v2 v2.2.0 // indirect - github.com/fatih/color v1.9.0 // indirect - github.com/felixge/httpsnoop v1.0.2 // indirect - github.com/fsnotify/fsnotify v1.4.9 // indirect + github.com/fatih/color v1.15.0 // indirect + github.com/felixge/httpsnoop v1.0.3 // indirect + github.com/fsnotify/fsnotify v1.6.0 // indirect github.com/golang/protobuf v1.5.3 // indirect github.com/google/go-cmp v0.5.9 // indirect - github.com/hashicorp/go-cleanhttp v0.5.1 // indirect - github.com/hashicorp/go-hclog v0.14.1 // indirect - github.com/hashicorp/go-immutable-radix v1.3.0 // indirect + github.com/hashicorp/go-cleanhttp v0.5.2 // indirect + github.com/hashicorp/go-hclog v1.5.0 // indirect + github.com/hashicorp/go-immutable-radix v1.3.1 // indirect github.com/hashicorp/go-rootcerts v1.0.2 // indirect - github.com/hashicorp/golang-lru v0.5.4 // indirect + github.com/hashicorp/golang-lru v1.0.2 // indirect github.com/hashicorp/serf v0.10.1 // indirect - github.com/mattn/go-colorable v0.1.6 // indirect - github.com/mattn/go-isatty v0.0.12 // indirect + github.com/mattn/go-colorable v0.1.13 // indirect + github.com/mattn/go-isatty v0.0.19 // indirect github.com/matttproud/golang_protobuf_extensions v1.0.4 // indirect github.com/mitchellh/go-homedir v1.1.0 // indirect - github.com/mitchellh/mapstructure v1.4.1 // indirect + github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/nxadm/tail v1.4.8 // indirect - github.com/prometheus/procfs v0.11.1 // indirect - golang.org/x/mod v0.8.0 // indirect - golang.org/x/net v0.10.0 // indirect - golang.org/x/sys v0.11.0 // indirect - golang.org/x/text v0.9.0 // indirect - golang.org/x/tools v0.6.0 // indirect + github.com/prometheus/procfs v0.12.0 // indirect + golang.org/x/exp v0.0.0-20230905200255-921286631fa9 // indirect + golang.org/x/mod v0.12.0 // indirect + golang.org/x/net v0.15.0 // indirect + golang.org/x/sys v0.12.0 // indirect + golang.org/x/text v0.13.0 // indirect + golang.org/x/tools v0.13.0 // indirect google.golang.org/protobuf v1.31.0 // indirect gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) + +replace github.com/armon/go-metrics => github.com/hashicorp/go-metrics v0.4.1 diff --git a/go.sum b/go.sum index 8b06f08..ca3434c 100644 --- a/go.sum +++ b/go.sum @@ -9,9 +9,6 @@ github.com/alecthomas/units v0.0.0-20190717042225-c3de453c63f4/go.mod h1:ybxpYRF github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 h1:s6gZFSlWYmbqAuRjVTiNNhvNRfY2Wxp9nhfyel4rklc= github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137/go.mod h1:OMCwj8VM1Kc9e19TLln2VL61YJF0x1XFtfdL4JdbSyE= github.com/armon/circbuf v0.0.0-20150827004946-bbbad097214e/go.mod h1:3U/XgcO3hCbHZ8TKRvWD2dDTCfh9M9ya+I9JpbB7O8o= -github.com/armon/go-metrics v0.0.0-20180917152333-f0300d1749da/go.mod h1:Q73ZrmVTwzkszR9V5SSuryQ31EELlFMUz1kKyl939pY= -github.com/armon/go-metrics v0.3.10 h1:FR+drcQStOe+32sYyJYyZ7FIdgoGGBnwLl+flodp8Uo= -github.com/armon/go-metrics v0.3.10/go.mod h1:4O98XIr/9W0sxpJ8UaYkvjk10Iff7SnFrb4QAOwNTFc= github.com/armon/go-radix v0.0.0-20180808171621-7fddfc383310/go.mod h1:ufUuZ+zHj4x4TnLV4JWEpy2hxWSpsRywHrMgIH9cCH8= github.com/armon/go-radix v1.0.0/go.mod h1:ufUuZ+zHj4x4TnLV4JWEpy2hxWSpsRywHrMgIH9cCH8= github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q= @@ -25,23 +22,31 @@ github.com/cespare/xxhash/v2 v2.2.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XL github.com/circonus-labs/circonus-gometrics v2.3.1+incompatible/go.mod h1:nmEj6Dob7S7YxXgwXpfOuvO54S+tGdZdw9fuRZt25Ag= github.com/circonus-labs/circonusllhist v0.1.3/go.mod h1:kMXHVDlOchFAehlya5ePtbp5jckzBHf4XRpQvBOLI+I= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/fatih/color v1.7.0/go.mod h1:Zm6kSWBoL9eyXnKyktHP6abPY2pDugNf5KwzbycvMj4= -github.com/fatih/color v1.9.0 h1:8xPHl4/q1VyqGIPif1F+1V3Y3lSmrq01EabUW3CoW5s= github.com/fatih/color v1.9.0/go.mod h1:eQcE1qtQxscV5RaZvpXrrb8Drkc3/DdQ+uUYCNjL+zU= +github.com/fatih/color v1.13.0/go.mod h1:kLAiJbzzSOZDVNGyDpeOxJ47H46qBXwg5ILebYFFOfk= +github.com/fatih/color v1.15.0 h1:kOqh6YHBtK8aywxGerMG2Eq3H6Qgoqeo13Bk2Mv/nBs= +github.com/fatih/color v1.15.0/go.mod h1:0h5ZqXfHYED7Bhv2ZJamyIOUej9KtShiJESRwBDUSsw= github.com/felixge/httpsnoop v1.0.1/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= -github.com/felixge/httpsnoop v1.0.2 h1:+nS9g82KMXccJ/wp0zyRW9ZBHFETmMGtkk+2CTTrW4o= -github.com/felixge/httpsnoop v1.0.2/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= +github.com/felixge/httpsnoop v1.0.3 h1:s/nj+GCswXYzN5v2DpNMuMQYe+0DDwt5WVCU6CWBdXk= +github.com/felixge/httpsnoop v1.0.3/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMoQvtojpjFo= -github.com/fsnotify/fsnotify v1.4.9 h1:hsms1Qyu0jgnwNXIxa+/V/PDsU6CfLf6CNO8H7IWoS4= github.com/fsnotify/fsnotify v1.4.9/go.mod h1:znqG4EE+3YCdAaPaxE2ZRY/06pZUdp0tY4IgpuI1SZQ= +github.com/fsnotify/fsnotify v1.6.0 h1:n+5WquG0fcWoWp6xPWfHdbskMCQaFnG6PfBrh1Ky4HY= +github.com/fsnotify/fsnotify v1.6.0/go.mod h1:sl3t1tCWJFWoRz9R8WJCbQihKKwmorjAbSClcnxKAGw= github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-kit/kit v0.9.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= +github.com/go-logr/logr v1.2.4 h1:g01GSCwiDw2xSZfjJ2/T9M+S6pFdcNtFYsp+Y43HYDQ= +github.com/go-logr/logr v1.2.4/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= github.com/go-task/slim-sprig v0.0.0-20210107165309-348f09dbbbc0/go.mod h1:fyg7847qk6SyHyPtNmDHnmrv/HOrqktSC+C9fM+CJOE= +github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 h1:tfuBGBXKqDEevZMzYi5KSi8KkcZtzBcTgAUUtapy0OI= +github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572/go.mod h1:9Pwr4B2jHnOSGXyyzV8ROjYa2ojvAY6HCGYYfMoC3Ls= github.com/gogo/protobuf v1.1.1/go.mod h1:r8qH/GZQm5c6nD/R0oafs1akxWv10x8SbQlK7atdtwQ= github.com/golang/protobuf v1.2.0/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= github.com/golang/protobuf v1.3.1/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= @@ -55,8 +60,9 @@ github.com/golang/protobuf v1.4.2/go.mod h1:oDoupMAO8OvCJWAcko0GGGIgR6R6ocIYbsSw github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk= github.com/golang/protobuf v1.5.3 h1:KhyjKVUg7Usr/dYsdSqoFveMYd5ko72D+zANwlG1mmg= github.com/golang/protobuf v1.5.3/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY= -github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c h1:964Od4U6p2jUkFxvCydnIczKteheJEzHRToSGK3Bnlw= github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ= +github.com/google/btree v1.0.1 h1:gK4Kx5IaGY9CD5sPJ36FHiBJ6ZXl0kilRiiCj+jdYp4= +github.com/google/btree v1.0.1/go.mod h1:xXMiIv4Fb/0kKde4SpL7qlzvu5cMJDRkFDxJfI9uaxA= github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= @@ -64,29 +70,36 @@ github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= +github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38 h1:yAJXTCF9TqKcTiHJAE8dj7HMvPfh66eeA2JYW7eFpSE= +github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38/go.mod h1:kpwsk12EmLew5upagYY7GY0pfYCcupk39gWOCRROcvE= github.com/gorilla/handlers v1.5.1 h1:9lRY6j8DEeeBT10CvO9hGW0gmky0BprnvDI5vfhUHH4= github.com/gorilla/handlers v1.5.1/go.mod h1:t8XrUpc4KVXb7HGyJ4/cEnwQiaxrX/hz1Zv/4g96P1Q= github.com/gorilla/mux v1.8.0 h1:i40aqfkR1h2SlN9hojwV5ZA91wcXFOvkdNIeFDP5koI= github.com/gorilla/mux v1.8.0/go.mod h1:DVbg23sWSpFRCP0SfiEN6jmj59UnW/n46BH5rLB71So= -github.com/hashicorp/consul/api v1.21.0 h1:WMR2JiyuaQWRAMFaOGiYfY4Q4HRpyYRe/oYQofjyduM= -github.com/hashicorp/consul/api v1.21.0/go.mod h1:f8zVJwBcLdr1IQnfdfszjUM0xzp31Zl3bpws3pL9uFM= -github.com/hashicorp/consul/sdk v0.13.1 h1:EygWVWWMczTzXGpO93awkHFzfUka6hLYJ0qhETd+6lY= -github.com/hashicorp/consul/sdk v0.13.1/go.mod h1:SW/mM4LbKfqmMvcFu8v+eiQQ7oitXEFeiBe9StxERb0= -github.com/hashicorp/errwrap v1.0.0 h1:hLrqtEDnRye3+sgx6z4qVLNuviH3MR5aQ0ykNJa/UYA= +github.com/hashicorp/consul/api v1.25.1 h1:CqrdhYzc8XZuPnhIYZWH45toM0LB9ZeYr/gvpLVI3PE= +github.com/hashicorp/consul/api v1.25.1/go.mod h1:iiLVwR/htV7mas/sy0O+XSuEnrdBUUydemjxcUrAt4g= +github.com/hashicorp/consul/sdk v0.14.1 h1:ZiwE2bKb+zro68sWzZ1SgHF3kRMBZ94TwOCFRF4ylPs= +github.com/hashicorp/consul/sdk v0.14.1/go.mod h1:vFt03juSzocLRFo59NkeQHHmQa6+g7oU0pfzdI1mUhg= github.com/hashicorp/errwrap v1.0.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= +github.com/hashicorp/errwrap v1.1.0 h1:OxrOeh75EUXMY8TBjag2fzXGZ40LB6IKw45YeGUDY2I= +github.com/hashicorp/errwrap v1.1.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= github.com/hashicorp/go-cleanhttp v0.5.0/go.mod h1:JpRdi6/HCYpAwUzNwuwqhbovhLtngrth3wmdIIUrZ80= -github.com/hashicorp/go-cleanhttp v0.5.1 h1:dH3aiDG9Jvb5r5+bYHsikaOUIpcM0xvgMXVoDkXMzJM= -github.com/hashicorp/go-cleanhttp v0.5.1/go.mod h1:JpRdi6/HCYpAwUzNwuwqhbovhLtngrth3wmdIIUrZ80= -github.com/hashicorp/go-hclog v0.14.1 h1:nQcJDQwIAGnmoUWp8ubocEX40cCml/17YkF6csQLReU= -github.com/hashicorp/go-hclog v0.14.1/go.mod h1:whpDNt7SSdeAju8AWKIWsul05p54N/39EeqMAyrmvFQ= +github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= +github.com/hashicorp/go-cleanhttp v0.5.2/go.mod h1:kO/YDlP8L1346E6Sodw+PrpBSV4/SoxCXGY6BqNFT48= +github.com/hashicorp/go-hclog v1.5.0 h1:bI2ocEMgcVlz55Oj1xZNBsVi900c7II+fWDyV9o+13c= +github.com/hashicorp/go-hclog v1.5.0/go.mod h1:W4Qnvbt70Wk/zYJryRzDRU/4r0kIg0PVHBcfoyhpF5M= github.com/hashicorp/go-immutable-radix v1.0.0/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= -github.com/hashicorp/go-immutable-radix v1.3.0 h1:8exGP7ego3OmkfksihtSouGMZ+hQrhxx+FVELeXpVPE= -github.com/hashicorp/go-immutable-radix v1.3.0/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= -github.com/hashicorp/go-msgpack v0.5.3 h1:zKjpN5BK/P5lMYrLmBHdBULWbJ0XpYR+7NGzqkZzoD4= +github.com/hashicorp/go-immutable-radix v1.3.1 h1:DKHmCUm2hRBK510BaiZlwvpD40f8bJFeZnpfm2KLowc= +github.com/hashicorp/go-immutable-radix v1.3.1/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= +github.com/hashicorp/go-metrics v0.4.1 h1:3CTMzft9hdMnx2CKrEPjJqwdMAN/ij7bjqzNo+JpVZ4= +github.com/hashicorp/go-metrics v0.4.1/go.mod h1:E6amYzXo6aW1tqzoZGT755KkbgrJsSdpwZ+3JqfkOG4= github.com/hashicorp/go-msgpack v0.5.3/go.mod h1:ahLV/dePpqEmjfWmKiqvPkv/twdG7iPBM1vqhUKIvfM= +github.com/hashicorp/go-msgpack v0.5.5 h1:i9R9JSrqIz0QVLz3sz+i3YJdT7TTSLcfLLzJi9aZTuI= +github.com/hashicorp/go-msgpack v0.5.5/go.mod h1:ahLV/dePpqEmjfWmKiqvPkv/twdG7iPBM1vqhUKIvfM= github.com/hashicorp/go-multierror v1.0.0/go.mod h1:dHtQlpGsu+cZNNAkkCN/P3hoUDHhCYQXV3UM06sGGrk= -github.com/hashicorp/go-multierror v1.1.0 h1:B9UzwGQJehnUY1yNrnwREHc3fGbC2xefo8g4TbElacI= github.com/hashicorp/go-multierror v1.1.0/go.mod h1:spPvp8C1qA32ftKqdAHm4hHTbPw+vmowP0z+KUhOZdA= +github.com/hashicorp/go-multierror v1.1.1 h1:H5DkEtf6CXdFp0N0Em5UCwQpXMWke8IA0+lD48awMYo= +github.com/hashicorp/go-multierror v1.1.1/go.mod h1:iw975J/qwKPdAO1clOe2L8331t/9/fmwbPZ6JB6eMoM= github.com/hashicorp/go-retryablehttp v0.5.3/go.mod h1:9B5zBasrRhHXnJnui7y6sL7es7NDiJgTc6Er0maI1Xs= github.com/hashicorp/go-rootcerts v1.0.2 h1:jzhAVGtqPKbwpyCPELlgNWhE1znq+qwJtW5Oi2viEzc= github.com/hashicorp/go-rootcerts v1.0.2/go.mod h1:pqUvnprVnM5bf7AOirdbb01K4ccR319Vf4pU3K5EGc8= @@ -96,13 +109,13 @@ github.com/hashicorp/go-sockaddr v1.0.2/go.mod h1:rB4wwRAUzs07qva3c5SdrY/NEtAUjG github.com/hashicorp/go-syslog v1.0.0/go.mod h1:qPfqrKkXGihmCqbJM2mZgkZGvKG1dFdvsLplgctolz4= github.com/hashicorp/go-uuid v1.0.0/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= github.com/hashicorp/go-uuid v1.0.1/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= -github.com/hashicorp/go-uuid v1.0.2 h1:cfejS+Tpcp13yd5nYHWDI6qVCny6wyX2Mt5SGur2IGE= -github.com/hashicorp/go-uuid v1.0.2/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= +github.com/hashicorp/go-uuid v1.0.3 h1:2gKiV6YVmrJ1i2CKKa9obLvRieoRGviZFL26PcT/Co8= +github.com/hashicorp/go-uuid v1.0.3/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= github.com/hashicorp/go-version v1.2.1 h1:zEfKbn2+PDgroKdiOzqiE8rsmLqU2uwi5PB5pBJ3TkI= github.com/hashicorp/go-version v1.2.1/go.mod h1:fltr4n8CU8Ke44wwGCBoEymUuxUHl09ZGVZPK5anwXA= github.com/hashicorp/golang-lru v0.5.0/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8= -github.com/hashicorp/golang-lru v0.5.4 h1:YDjusn29QI/Das2iO9M0BHnIbxPeyuCHsjMW+lJfyTc= -github.com/hashicorp/golang-lru v0.5.4/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4= +github.com/hashicorp/golang-lru v1.0.2 h1:dV3g9Z/unq5DpblPpw+Oqcv4dU/1omnb4Ok8iPY6p1c= +github.com/hashicorp/golang-lru v1.0.2/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4= github.com/hashicorp/logutils v1.0.0/go.mod h1:QIAnNjmIWmVIIkWDTG1z5v++HQmx9WQRO+LraFDTW64= github.com/hashicorp/mdns v1.0.4/go.mod h1:mtBihi+LeNXGtG8L9dX59gAEa12BDtBQSp4v/YAJqrc= github.com/hashicorp/memberlist v0.5.0 h1:EtYPN8DpAURiapus508I4n9CzHs2W+8NZGbmmR/prTM= @@ -124,14 +137,19 @@ github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/mattn/go-colorable v0.0.9/go.mod h1:9vuHe8Xs5qXnSaW/c/ABM9alt+Vo+STaOChaDxuIBZU= github.com/mattn/go-colorable v0.1.4/go.mod h1:U0ppj6V5qS13XJ6of8GYAs25YV2eR4EVcfRqFIhoBtE= -github.com/mattn/go-colorable v0.1.6 h1:6Su7aK7lXmJ/U79bYtBjLNaha4Fs1Rg9plHpcH+vvnE= github.com/mattn/go-colorable v0.1.6/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= +github.com/mattn/go-colorable v0.1.9/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= +github.com/mattn/go-colorable v0.1.12/go.mod h1:u5H1YNBxpqRaxsYJYSkiCWKzEfiAb1Gb520KVy5xxl4= +github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= +github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= github.com/mattn/go-isatty v0.0.3/go.mod h1:M+lRXTBqGeGNdLjl/ufCoiOlB5xdOkqRJdNxMWT7Zi4= github.com/mattn/go-isatty v0.0.8/go.mod h1:Iq45c/XA43vh69/j3iqttzPXn0bhXyGjM0Hdxcsrc5s= -github.com/mattn/go-isatty v0.0.10/go.mod h1:qgIWMr58cqv1PHHyhnkY9lrL7etaEgOFcMEpPG5Rm84= github.com/mattn/go-isatty v0.0.11/go.mod h1:PhnuNfih5lzO57/f3n+odYbM4JtupLOxQOAqxQCu2WE= -github.com/mattn/go-isatty v0.0.12 h1:wuysRhFDzyxgEmMf5xjvJ2M9dZoWAXNNr5LSBS7uHXY= github.com/mattn/go-isatty v0.0.12/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= +github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94= +github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= +github.com/mattn/go-isatty v0.0.19 h1:JITubQf0MOLdlGRuRq+jtsDlekdYPia9ZFsB8h/APPA= +github.com/mattn/go-isatty v0.0.19/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= github.com/matttproud/golang_protobuf_extensions v1.0.4 h1:mmDVorXM7PCGKw94cs5zkfA9PSy5pEvNWRP0ET0TIVo= github.com/matttproud/golang_protobuf_extensions v1.0.4/go.mod h1:BSXmuO+STAnVfrANrmjBb36TMTDstsz7MSK+HVaYKv4= @@ -144,8 +162,8 @@ github.com/mitchellh/cli v1.1.0/go.mod h1:xcISNoH86gajksDmfB23e/pu+B+GeFRMYmoHXx github.com/mitchellh/go-homedir v1.1.0 h1:lukF9ziXFxDFPkA1vsr5zpc1XuPDn/wFntq5mG+4E0Y= github.com/mitchellh/go-homedir v1.1.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0= github.com/mitchellh/mapstructure v0.0.0-20160808181253-ca63d7c062ee/go.mod h1:FVVH3fgwuzCH5S8UJGiWEs2h04kUh9fWfEaFds41c1Y= -github.com/mitchellh/mapstructure v1.4.1 h1:CpVNEelQCZBooIPDn+AR3NpivK/TIKU8bDxdASFVQag= -github.com/mitchellh/mapstructure v1.4.1/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= +github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= +github.com/mitchellh/mapstructure v1.5.0/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/reflect2 v0.0.0-20180701023420-4b7aa43c6742/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= @@ -158,12 +176,12 @@ github.com/onsi/ginkgo v1.6.0/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+W github.com/onsi/ginkgo v1.12.1/go.mod h1:zj2OWP4+oCPe1qIXoGWkgMRwljMUYCdkwsT2108oapk= github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE= github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU= -github.com/onsi/ginkgo/v2 v2.3.0 h1:kUMoxMoQG3ogk/QWyKh3zibV7BKZ+xBpWil1cTylVqc= -github.com/onsi/ginkgo/v2 v2.3.0/go.mod h1:Eew0uilEqZmIEZr8JrvYlvOM7Rr6xzTmMV8AyFNU9d0= +github.com/onsi/ginkgo/v2 v2.11.0 h1:WgqUCUt/lT6yXoQ8Wef0fsNn5cAuMK7+KT9UFRz2tcU= +github.com/onsi/ginkgo/v2 v2.11.0/go.mod h1:ZhrRA5XmEE3x3rhlzamx/JJvujdZoJ2uvgI7kR0iZvM= github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY= github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo= -github.com/onsi/gomega v1.22.1 h1:pY8O4lBfsHKZHM/6nrxkhVPUznOlIu3quZcKP/M20KI= -github.com/onsi/gomega v1.22.1/go.mod h1:x6n7VNe4hw0vkyYUM4mjIXx3JbLiPaBPNgB7PRQ1tuM= +github.com/onsi/gomega v1.27.10 h1:naR28SdDFlqrG6kScpT8VWpu1xWY5nJRCF3XaYyBjhI= +github.com/onsi/gomega v1.27.10/go.mod h1:RsS8tutOdbdgzbPtzzATp12yT7kM5I5aElG3evPbQ0M= github.com/pascaldekloe/goe v0.0.0-20180627143212-57f6aae5913c/go.mod h1:lzWF7FIEvWOWxwDKqyGYQf6ZUaNfKdP144TG7ZOy1lc= github.com/pascaldekloe/goe v0.1.0 h1:cBOtyMzM9HTpWjXfbbunk26uA6nG3a8n06Wieeh0MwY= github.com/pascaldekloe/goe v0.1.0/go.mod h1:lzWF7FIEvWOWxwDKqyGYQf6ZUaNfKdP144TG7ZOy1lc= @@ -171,8 +189,9 @@ github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINE github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= -github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndrE9hABlRI= github.com/posener/complete v1.2.3/go.mod h1:WZIdtGGp+qx0sLrYKtIRAruyNpv6hFCicSgv7Sy7s/s= github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= @@ -192,8 +211,8 @@ github.com/prometheus/common v0.44.0/go.mod h1:ofAIvZbQ1e/nugmZGz4/qCb9Ap1VoSTIO github.com/prometheus/procfs v0.0.0-20181005140218-185b4288413d/go.mod h1:c3At6R/oaqEKCNdg8wHV1ftS6bRYblBhIjjI8uT2IGk= github.com/prometheus/procfs v0.0.2/go.mod h1:TjEm7ze935MbeOT/UhFTIMYKhuLP4wbCsTZCD3I8kEA= github.com/prometheus/procfs v0.0.8/go.mod h1:7Qr8sr6344vo1JqZ6HhLceV9o3AJ1Ff+GxbHq6oeK9A= -github.com/prometheus/procfs v0.11.1 h1:xRC8Iq1yyca5ypa9n1EZnWZkt7dwcoRPQwX/5gwaUuI= -github.com/prometheus/procfs v0.11.1/go.mod h1:eesXgaPo1q7lBpVMoMy0ZOFTth9hBn4W/y0/p/ScXhY= +github.com/prometheus/procfs v0.12.0 h1:jluTpSng7V9hY0O2R9DzzJHYb2xULk9VTR1V1R/k6Bo= +github.com/prometheus/procfs v0.12.0/go.mod h1:pcuDEFsWDnvcgNzo4EEweacyhjeA9Zk3cnaOZAZEfOo= github.com/rogpeppe/go-internal v1.10.0 h1:TMyTOH3F/DB16zRVcYyreMH6GnZZrwQVAoYjRBZyWFQ= github.com/rogpeppe/go-internal v1.10.0/go.mod h1:UQnix2H7Ngw/k4C5ijL5+65zddjncjaFoBhdsK/akog= github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf35Ld67mk= @@ -208,14 +227,17 @@ github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6Mwd github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= github.com/sirupsen/logrus v1.9.3/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= -github.com/stretchr/objx v0.1.1 h1:2vfRuCMp5sSVIDSqO8oNnWJq7mPa6KVP3iPIwFBuy8A= github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= +github.com/stretchr/objx v0.5.0 h1:1zr/of2m5FGMsad5YfcqgdqdWrIhu+EBEJRhR1U7z/c= +github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo= github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= -github.com/stretchr/testify v1.7.0 h1:nwc3DEeHmmLAfoZucVR881uASk0Mfjw8xYJ99tb5CcY= github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +github.com/stretchr/testify v1.7.2/go.mod h1:R6va5+xMeoiuVRoj+gSkQ7d3FALtqAAGI1FQKckRals= +github.com/stretchr/testify v1.8.3 h1:RP3t2pwF7cMEbC1dqtB6poj3niw/9gnV4Cjg5oW5gtY= +github.com/stretchr/testify v1.8.3/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM= github.com/yuin/goldmark v1.2.1/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= @@ -223,9 +245,11 @@ golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACk golang.org/x/crypto v0.0.0-20190923035154-9ee001bba392/go.mod h1:/lpIB1dKB+9EgE3H3cr1v9wB50oz8l4C4h62xy7jSTY= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= +golang.org/x/exp v0.0.0-20230905200255-921286631fa9 h1:GoHiUyI/Tp2nVkLI2mCxVkOjsbSXD66ic0XW0js0R9g= +golang.org/x/exp v0.0.0-20230905200255-921286631fa9/go.mod h1:S2oDrQGGwySpoQPVqRShND87VCbxmc6bL1Yd2oYrm6k= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= -golang.org/x/mod v0.8.0 h1:LUYupSeNrTNCGzR/hVBk2NHZO4hXcVaW1k4Qx7rjPx8= -golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/mod v0.12.0 h1:rmsUpXtvNzj340zd98LZ4KntptpfRHwpFOHG188oHXc= +golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/net v0.0.0-20180906233101-161cd47e91fd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= @@ -236,8 +260,8 @@ golang.org/x/net v0.0.0-20200520004742-59133d7f0dd7/go.mod h1:qpuaurCH72eLCgpAm/ golang.org/x/net v0.0.0-20201021035429-f5854403a974/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU= golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg= golang.org/x/net v0.0.0-20210410081132-afb366fc7cd1/go.mod h1:9tjilg8BloeKEkVJvy7fQ90B1CfIiPueXVOjqfkSzI8= -golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= -golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= +golang.org/x/net v0.15.0 h1:ugBLEUaxABaB5AJqW9enI0ACdci2RUd4eP51NTBvuJ8= +golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -259,7 +283,6 @@ golang.org/x/sys v0.0.0-20190904154756-749cb33beabd/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20190922100055-0a153f010e69/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20190924154521-2837fb4f24fe/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191005200804-aed5e4c7ecf9/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/sys v0.0.0-20191008105621-543471e840be/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191120155948-bd437916bb0e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200116001909-b77594299b42/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= @@ -271,23 +294,29 @@ golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20210112080510-489259a85091/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210303074136-134d130e1a04/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210330210617-4fbd30eecc44/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220728004956-3c1f35247d10/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.11.0 h1:eG7RXZHdqOJ1i+0lgLgCpSXAp6M3LYlAo6osgSi0xOM= -golang.org/x/sys v0.11.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.12.0 h1:CM0HF96J0hcLAwsHPJZjfdNzs0gftsLfgKt57wWHJ0o= +golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= +golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20190907020128-2ca718005c18/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.0.0-20201224043029-2b0845dc783e/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= -golang.org/x/tools v0.6.0 h1:BOw41kyTf3PuCW1pVQf8+Cyg8pMlkYB1oo9iJ6D/lKM= -golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= +golang.org/x/tools v0.13.0 h1:Iey4qkscZuv0VvIt8E0neZjtPVQFSc870HQ448QgEmQ= +golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= diff --git a/vendor/github.com/armon/go-metrics/metrics.go b/vendor/github.com/armon/go-metrics/metrics.go index 6753b13..36642a4 100644 --- a/vendor/github.com/armon/go-metrics/metrics.go +++ b/vendor/github.com/armon/go-metrics/metrics.go @@ -5,7 +5,7 @@ import ( "strings" "time" - "github.com/hashicorp/go-immutable-radix" + iradix "github.com/hashicorp/go-immutable-radix" ) type Label struct { @@ -172,6 +172,12 @@ func (m *Metrics) UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabe } } +func (m *Metrics) Shutdown() { + if ss, ok := m.sink.(ShutdownSink); ok { + ss.Shutdown() + } +} + // labelIsAllowed return true if a should be included in metric // the caller should lock m.filterLock while calling this method func (m *Metrics) labelIsAllowed(label *Label) bool { diff --git a/vendor/github.com/armon/go-metrics/sink.go b/vendor/github.com/armon/go-metrics/sink.go index 0b7d6e4..6f4108f 100644 --- a/vendor/github.com/armon/go-metrics/sink.go +++ b/vendor/github.com/armon/go-metrics/sink.go @@ -24,6 +24,15 @@ type MetricSink interface { AddSampleWithLabels(key []string, val float32, labels []Label) } +type ShutdownSink interface { + MetricSink + + // Shutdown the metric sink, flush metrics to storage, and cleanup resources. + // Called immediately prior to application exit. Implementations must block + // until metrics are flushed to storage. + Shutdown() +} + // BlackholeSink is used to just blackhole messages type BlackholeSink struct{} @@ -74,6 +83,14 @@ func (fh FanoutSink) AddSampleWithLabels(key []string, val float32, labels []Lab } } +func (fh FanoutSink) Shutdown() { + for _, s := range fh { + if ss, ok := s.(ShutdownSink); ok { + ss.Shutdown() + } + } +} + // sinkURLFactoryFunc is an generic interface around the *SinkFromURL() function provided // by each sink type type sinkURLFactoryFunc func(*url.URL) (MetricSink, error) diff --git a/vendor/github.com/armon/go-metrics/start.go b/vendor/github.com/armon/go-metrics/start.go index 6aa0bd3..38976f8 100644 --- a/vendor/github.com/armon/go-metrics/start.go +++ b/vendor/github.com/armon/go-metrics/start.go @@ -144,3 +144,15 @@ func UpdateFilter(allow, block []string) { func UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels []string) { globalMetrics.Load().(*Metrics).UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels) } + +// Shutdown disables metric collection, then blocks while attempting to flush metrics to storage. +// WARNING: Not all MetricSink backends support this functionality, and calling this will cause them to leak resources. +// This is intended for use immediately prior to application exit. +func Shutdown() { + m := globalMetrics.Load().(*Metrics) + // Swap whatever MetricSink is currently active with a BlackholeSink. Callers must not have a + // reason to expect that calls to the library will successfully collect metrics after Shutdown + // has been called. + globalMetrics.Store(&Metrics{sink: &BlackholeSink{}}) + m.Shutdown() +} diff --git a/vendor/github.com/fatih/color/README.md b/vendor/github.com/fatih/color/README.md index 42d9abc..be82827 100644 --- a/vendor/github.com/fatih/color/README.md +++ b/vendor/github.com/fatih/color/README.md @@ -1,21 +1,11 @@ -# Archived project. No maintenance. - -This project is not maintained anymore and is archived. Feel free to fork and -make your own changes if needed. For more detail read my blog post: [Taking an indefinite sabbatical from my projects](https://arslan.io/2018/10/09/taking-an-indefinite-sabbatical-from-my-projects/) - -Thanks to everyone for their valuable feedback and contributions. - - -# Color [![GoDoc](https://godoc.org/github.com/fatih/color?status.svg)](https://godoc.org/github.com/fatih/color) +# color [![](https://github.com/fatih/color/workflows/build/badge.svg)](https://github.com/fatih/color/actions) [![PkgGoDev](https://pkg.go.dev/badge/github.com/fatih/color)](https://pkg.go.dev/github.com/fatih/color) Color lets you use colorized outputs in terms of [ANSI Escape Codes](http://en.wikipedia.org/wiki/ANSI_escape_code#Colors) in Go (Golang). It has support for Windows too! The API can be used in several ways, pick one that suits you. - -![Color](https://i.imgur.com/c1JI0lA.png) - +![Color](https://user-images.githubusercontent.com/438920/96832689-03b3e000-13f4-11eb-9803-46f4c4de3406.jpg) ## Install @@ -87,7 +77,7 @@ notice("Don't forget this...") ### Custom fprint functions (FprintFunc) ```go -blue := color.New(FgBlue).FprintfFunc() +blue := color.New(color.FgBlue).FprintfFunc() blue(myWriter, "important notice: %s", stars) // Mix up with multiple attributes @@ -133,17 +123,19 @@ fmt.Println("All text will now be bold magenta.") ``` ### Disable/Enable color - + There might be a case where you want to explicitly disable/enable color output. the `go-isatty` package will automatically disable color output for non-tty output streams -(for example if the output were piped directly to `less`) +(for example if the output were piped directly to `less`). -`Color` has support to disable/enable colors both globally and for single color -definitions. For example suppose you have a CLI app and a `--no-color` bool flag. You -can easily disable the color output with: +The `color` package also disables color output if the [`NO_COLOR`](https://no-color.org) environment +variable is set to a non-empty string. -```go +`Color` has support to disable/enable colors programmatically both globally and +for single color definitions. For example suppose you have a CLI app and a +`-no-color` bool flag. You can easily disable the color output with: +```go var flagNoColor = flag.Bool("no-color", false, "Disable color output") if *flagNoColor { @@ -165,18 +157,20 @@ c.EnableColor() c.Println("This prints again cyan...") ``` +## GitHub Actions + +To output color in GitHub Actions (or other CI systems that support ANSI colors), make sure to set `color.NoColor = false` so that it bypasses the check for non-tty output streams. + ## Todo * Save/Return previous values * Evaluate fmt.Formatter interface - ## Credits - * [Fatih Arslan](https://github.com/fatih) - * Windows support via @mattn: [colorable](https://github.com/mattn/go-colorable) +* [Fatih Arslan](https://github.com/fatih) +* Windows support via @mattn: [colorable](https://github.com/mattn/go-colorable) ## License The MIT License (MIT) - see [`LICENSE.md`](https://github.com/fatih/color/blob/master/LICENSE.md) for more details - diff --git a/vendor/github.com/fatih/color/color.go b/vendor/github.com/fatih/color/color.go index 91c8e9f..889f9e7 100644 --- a/vendor/github.com/fatih/color/color.go +++ b/vendor/github.com/fatih/color/color.go @@ -15,12 +15,14 @@ import ( var ( // NoColor defines if the output is colorized or not. It's dynamically set to // false or true based on the stdout's file descriptor referring to a terminal - // or not. This is a global option and affects all colors. For more control - // over each color block use the methods DisableColor() individually. - NoColor = os.Getenv("TERM") == "dumb" || + // or not. It's also set to true if the NO_COLOR environment variable is + // set (regardless of its value). This is a global option and affects all + // colors. For more control over each color block use the methods + // DisableColor() individually. + NoColor = noColorIsSet() || os.Getenv("TERM") == "dumb" || (!isatty.IsTerminal(os.Stdout.Fd()) && !isatty.IsCygwinTerminal(os.Stdout.Fd())) - // Output defines the standard output of the print functions. By default + // Output defines the standard output of the print functions. By default, // os.Stdout is used. Output = colorable.NewColorableStdout() @@ -33,6 +35,11 @@ var ( colorsCacheMu sync.Mutex // protects colorsCache ) +// noColorIsSet returns true if the environment variable NO_COLOR is set to a non-empty string. +func noColorIsSet() bool { + return os.Getenv("NO_COLOR") != "" +} + // Color defines a custom color object which is defined by SGR parameters. type Color struct { params []Attribute @@ -108,7 +115,14 @@ const ( // New returns a newly created color object. func New(value ...Attribute) *Color { - c := &Color{params: make([]Attribute, 0)} + c := &Color{ + params: make([]Attribute, 0), + } + + if noColorIsSet() { + c.noColor = boolPtr(true) + } + c.Add(value...) return c } @@ -137,7 +151,7 @@ func (c *Color) Set() *Color { return c } - fmt.Fprintf(Output, c.format()) + fmt.Fprint(Output, c.format()) return c } @@ -149,16 +163,21 @@ func (c *Color) unset() { Unset() } -func (c *Color) setWriter(w io.Writer) *Color { +// SetWriter is used to set the SGR sequence with the given io.Writer. This is +// a low-level function, and users should use the higher-level functions, such +// as color.Fprint, color.Print, etc. +func (c *Color) SetWriter(w io.Writer) *Color { if c.isNoColorSet() { return c } - fmt.Fprintf(w, c.format()) + fmt.Fprint(w, c.format()) return c } -func (c *Color) unsetWriter(w io.Writer) { +// UnsetWriter resets all escape attributes and clears the output with the give +// io.Writer. Usually should be called after SetWriter(). +func (c *Color) UnsetWriter(w io.Writer) { if c.isNoColorSet() { return } @@ -177,20 +196,14 @@ func (c *Color) Add(value ...Attribute) *Color { return c } -func (c *Color) prepend(value Attribute) { - c.params = append(c.params, 0) - copy(c.params[1:], c.params[0:]) - c.params[0] = value -} - // Fprint formats using the default formats for its operands and writes to w. // Spaces are added between operands when neither is a string. // It returns the number of bytes written and any write error encountered. // On Windows, users should wrap w with colorable.NewColorable() if w is of // type *os.File. func (c *Color) Fprint(w io.Writer, a ...interface{}) (n int, err error) { - c.setWriter(w) - defer c.unsetWriter(w) + c.SetWriter(w) + defer c.UnsetWriter(w) return fmt.Fprint(w, a...) } @@ -212,8 +225,8 @@ func (c *Color) Print(a ...interface{}) (n int, err error) { // On Windows, users should wrap w with colorable.NewColorable() if w is of // type *os.File. func (c *Color) Fprintf(w io.Writer, format string, a ...interface{}) (n int, err error) { - c.setWriter(w) - defer c.unsetWriter(w) + c.SetWriter(w) + defer c.UnsetWriter(w) return fmt.Fprintf(w, format, a...) } @@ -233,8 +246,8 @@ func (c *Color) Printf(format string, a ...interface{}) (n int, err error) { // On Windows, users should wrap w with colorable.NewColorable() if w is of // type *os.File. func (c *Color) Fprintln(w io.Writer, a ...interface{}) (n int, err error) { - c.setWriter(w) - defer c.unsetWriter(w) + c.SetWriter(w) + defer c.UnsetWriter(w) return fmt.Fprintln(w, a...) } @@ -381,13 +394,13 @@ func (c *Color) DisableColor() { } // EnableColor enables the color output. Use it in conjunction with -// DisableColor(). Otherwise this method has no side effects. +// DisableColor(). Otherwise, this method has no side effects. func (c *Color) EnableColor() { c.noColor = boolPtr(false) } func (c *Color) isNoColorSet() bool { - // check first if we have user setted action + // check first if we have user set action if c.noColor != nil { return *c.noColor } diff --git a/vendor/github.com/fatih/color/color_windows.go b/vendor/github.com/fatih/color/color_windows.go new file mode 100644 index 0000000..be01c55 --- /dev/null +++ b/vendor/github.com/fatih/color/color_windows.go @@ -0,0 +1,19 @@ +package color + +import ( + "os" + + "golang.org/x/sys/windows" +) + +func init() { + // Opt-in for ansi color support for current process. + // https://learn.microsoft.com/en-us/windows/console/console-virtual-terminal-sequences#output-sequences + var outMode uint32 + out := windows.Handle(os.Stdout.Fd()) + if err := windows.GetConsoleMode(out, &outMode); err != nil { + return + } + outMode |= windows.ENABLE_PROCESSED_OUTPUT | windows.ENABLE_VIRTUAL_TERMINAL_PROCESSING + _ = windows.SetConsoleMode(out, outMode) +} diff --git a/vendor/github.com/fatih/color/doc.go b/vendor/github.com/fatih/color/doc.go index cf1e965..9491ad5 100644 --- a/vendor/github.com/fatih/color/doc.go +++ b/vendor/github.com/fatih/color/doc.go @@ -5,106 +5,105 @@ that suits you. Use simple and default helper functions with predefined foreground colors: - color.Cyan("Prints text in cyan.") + color.Cyan("Prints text in cyan.") - // a newline will be appended automatically - color.Blue("Prints %s in blue.", "text") + // a newline will be appended automatically + color.Blue("Prints %s in blue.", "text") - // More default foreground colors.. - color.Red("We have red") - color.Yellow("Yellow color too!") - color.Magenta("And many others ..") + // More default foreground colors.. + color.Red("We have red") + color.Yellow("Yellow color too!") + color.Magenta("And many others ..") - // Hi-intensity colors - color.HiGreen("Bright green color.") - color.HiBlack("Bright black means gray..") - color.HiWhite("Shiny white color!") + // Hi-intensity colors + color.HiGreen("Bright green color.") + color.HiBlack("Bright black means gray..") + color.HiWhite("Shiny white color!") -However there are times where custom color mixes are required. Below are some +However, there are times when custom color mixes are required. Below are some examples to create custom color objects and use the print functions of each separate color object. - // Create a new color object - c := color.New(color.FgCyan).Add(color.Underline) - c.Println("Prints cyan text with an underline.") + // Create a new color object + c := color.New(color.FgCyan).Add(color.Underline) + c.Println("Prints cyan text with an underline.") - // Or just add them to New() - d := color.New(color.FgCyan, color.Bold) - d.Printf("This prints bold cyan %s\n", "too!.") + // Or just add them to New() + d := color.New(color.FgCyan, color.Bold) + d.Printf("This prints bold cyan %s\n", "too!.") - // Mix up foreground and background colors, create new mixes! - red := color.New(color.FgRed) + // Mix up foreground and background colors, create new mixes! + red := color.New(color.FgRed) - boldRed := red.Add(color.Bold) - boldRed.Println("This will print text in bold red.") + boldRed := red.Add(color.Bold) + boldRed.Println("This will print text in bold red.") - whiteBackground := red.Add(color.BgWhite) - whiteBackground.Println("Red text with White background.") + whiteBackground := red.Add(color.BgWhite) + whiteBackground.Println("Red text with White background.") - // Use your own io.Writer output - color.New(color.FgBlue).Fprintln(myWriter, "blue color!") + // Use your own io.Writer output + color.New(color.FgBlue).Fprintln(myWriter, "blue color!") - blue := color.New(color.FgBlue) - blue.Fprint(myWriter, "This will print text in blue.") + blue := color.New(color.FgBlue) + blue.Fprint(myWriter, "This will print text in blue.") You can create PrintXxx functions to simplify even more: - // Create a custom print function for convenient - red := color.New(color.FgRed).PrintfFunc() - red("warning") - red("error: %s", err) + // Create a custom print function for convenient + red := color.New(color.FgRed).PrintfFunc() + red("warning") + red("error: %s", err) - // Mix up multiple attributes - notice := color.New(color.Bold, color.FgGreen).PrintlnFunc() - notice("don't forget this...") + // Mix up multiple attributes + notice := color.New(color.Bold, color.FgGreen).PrintlnFunc() + notice("don't forget this...") You can also FprintXxx functions to pass your own io.Writer: - blue := color.New(FgBlue).FprintfFunc() - blue(myWriter, "important notice: %s", stars) - - // Mix up with multiple attributes - success := color.New(color.Bold, color.FgGreen).FprintlnFunc() - success(myWriter, don't forget this...") + blue := color.New(FgBlue).FprintfFunc() + blue(myWriter, "important notice: %s", stars) + // Mix up with multiple attributes + success := color.New(color.Bold, color.FgGreen).FprintlnFunc() + success(myWriter, don't forget this...") Or create SprintXxx functions to mix strings with other non-colorized strings: - yellow := New(FgYellow).SprintFunc() - red := New(FgRed).SprintFunc() + yellow := New(FgYellow).SprintFunc() + red := New(FgRed).SprintFunc() - fmt.Printf("this is a %s and this is %s.\n", yellow("warning"), red("error")) + fmt.Printf("this is a %s and this is %s.\n", yellow("warning"), red("error")) - info := New(FgWhite, BgGreen).SprintFunc() - fmt.Printf("this %s rocks!\n", info("package")) + info := New(FgWhite, BgGreen).SprintFunc() + fmt.Printf("this %s rocks!\n", info("package")) Windows support is enabled by default. All Print functions work as intended. -However only for color.SprintXXX functions, user should use fmt.FprintXXX and +However, only for color.SprintXXX functions, user should use fmt.FprintXXX and set the output to color.Output: - fmt.Fprintf(color.Output, "Windows support: %s", color.GreenString("PASS")) + fmt.Fprintf(color.Output, "Windows support: %s", color.GreenString("PASS")) - info := New(FgWhite, BgGreen).SprintFunc() - fmt.Fprintf(color.Output, "this %s rocks!\n", info("package")) + info := New(FgWhite, BgGreen).SprintFunc() + fmt.Fprintf(color.Output, "this %s rocks!\n", info("package")) Using with existing code is possible. Just use the Set() method to set the standard output to the given parameters. That way a rewrite of an existing code is not required. - // Use handy standard colors. - color.Set(color.FgYellow) + // Use handy standard colors. + color.Set(color.FgYellow) - fmt.Println("Existing text will be now in Yellow") - fmt.Printf("This one %s\n", "too") + fmt.Println("Existing text will be now in Yellow") + fmt.Printf("This one %s\n", "too") - color.Unset() // don't forget to unset + color.Unset() // don't forget to unset - // You can mix up parameters - color.Set(color.FgMagenta, color.Bold) - defer color.Unset() // use it in your function + // You can mix up parameters + color.Set(color.FgMagenta, color.Bold) + defer color.Unset() // use it in your function - fmt.Println("All text will be now bold magenta.") + fmt.Println("All text will be now bold magenta.") There might be a case where you want to disable color output (for example to pipe the standard output of your app to somewhere else). `Color` has support to @@ -112,22 +111,24 @@ disable colors both globally and for single color definition. For example suppose you have a CLI app and a `--no-color` bool flag. You can easily disable the color output with: - var flagNoColor = flag.Bool("no-color", false, "Disable color output") + var flagNoColor = flag.Bool("no-color", false, "Disable color output") + + if *flagNoColor { + color.NoColor = true // disables colorized output + } - if *flagNoColor { - color.NoColor = true // disables colorized output - } +You can also disable the color by setting the NO_COLOR environment variable to any value. It also has support for single color definitions (local). You can disable/enable color output on the fly: - c := color.New(color.FgCyan) - c.Println("Prints cyan text") + c := color.New(color.FgCyan) + c.Println("Prints cyan text") - c.DisableColor() - c.Println("This is printed without any color") + c.DisableColor() + c.Println("This is printed without any color") - c.EnableColor() - c.Println("This prints again cyan...") + c.EnableColor() + c.Println("This prints again cyan...") */ package color diff --git a/vendor/github.com/felixge/httpsnoop/capture_metrics.go b/vendor/github.com/felixge/httpsnoop/capture_metrics.go index c1d1b38..b77cc7c 100644 --- a/vendor/github.com/felixge/httpsnoop/capture_metrics.go +++ b/vendor/github.com/felixge/httpsnoop/capture_metrics.go @@ -35,9 +35,17 @@ func CaptureMetrics(hnd http.Handler, w http.ResponseWriter, r *http.Request) Me // sugar on top of this func), but is a more usable interface if your // application doesn't use the Go http.Handler interface. func CaptureMetricsFn(w http.ResponseWriter, fn func(http.ResponseWriter)) Metrics { + m := Metrics{Code: http.StatusOK} + m.CaptureMetrics(w, fn) + return m +} + +// CaptureMetrics wraps w and calls fn with the wrapped w and updates +// Metrics m with the resulting metrics. This is similar to CaptureMetricsFn, +// but allows one to customize starting Metrics object. +func (m *Metrics) CaptureMetrics(w http.ResponseWriter, fn func(http.ResponseWriter)) { var ( start = time.Now() - m = Metrics{Code: http.StatusOK} headerWritten bool hooks = Hooks{ WriteHeader: func(next WriteHeaderFunc) WriteHeaderFunc { @@ -74,6 +82,5 @@ func CaptureMetricsFn(w http.ResponseWriter, fn func(http.ResponseWriter)) Metri ) fn(Wrap(w, hooks)) - m.Duration = time.Since(start) - return m + m.Duration += time.Since(start) } diff --git a/vendor/github.com/fsnotify/fsnotify/.gitignore b/vendor/github.com/fsnotify/fsnotify/.gitignore index 4cd0cba..1d89d85 100644 --- a/vendor/github.com/fsnotify/fsnotify/.gitignore +++ b/vendor/github.com/fsnotify/fsnotify/.gitignore @@ -1,6 +1,6 @@ -# Setup a Global .gitignore for OS and editor generated files: -# https://help.github.com/articles/ignoring-files -# git config --global core.excludesfile ~/.gitignore_global +# go test -c output +*.test +*.test.exe -.vagrant -*.sublime-project +# Output of go build ./cmd/fsnotify +/fsnotify diff --git a/vendor/github.com/fsnotify/fsnotify/.mailmap b/vendor/github.com/fsnotify/fsnotify/.mailmap new file mode 100644 index 0000000..a04f290 --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/.mailmap @@ -0,0 +1,2 @@ +Chris Howey +Nathan Youngman <4566+nathany@users.noreply.github.com> diff --git a/vendor/github.com/fsnotify/fsnotify/.travis.yml b/vendor/github.com/fsnotify/fsnotify/.travis.yml deleted file mode 100644 index a9c3016..0000000 --- a/vendor/github.com/fsnotify/fsnotify/.travis.yml +++ /dev/null @@ -1,36 +0,0 @@ -sudo: false -language: go - -go: - - "stable" - - "1.11.x" - - "1.10.x" - - "1.9.x" - -matrix: - include: - - go: "stable" - env: GOLINT=true - allow_failures: - - go: tip - fast_finish: true - - -before_install: - - if [ ! -z "${GOLINT}" ]; then go get -u golang.org/x/lint/golint; fi - -script: - - go test --race ./... - -after_script: - - test -z "$(gofmt -s -l -w . | tee /dev/stderr)" - - if [ ! -z "${GOLINT}" ]; then echo running golint; golint --set_exit_status ./...; else echo skipping golint; fi - - go vet ./... - -os: - - linux - - osx - - windows - -notifications: - email: false diff --git a/vendor/github.com/fsnotify/fsnotify/AUTHORS b/vendor/github.com/fsnotify/fsnotify/AUTHORS deleted file mode 100644 index 5ab5d41..0000000 --- a/vendor/github.com/fsnotify/fsnotify/AUTHORS +++ /dev/null @@ -1,52 +0,0 @@ -# Names should be added to this file as -# Name or Organization -# The email address is not required for organizations. - -# You can update this list using the following command: -# -# $ git shortlog -se | awk '{print $2 " " $3 " " $4}' - -# Please keep the list sorted. - -Aaron L -Adrien Bustany -Amit Krishnan -Anmol Sethi -Bjørn Erik Pedersen -Bruno Bigras -Caleb Spare -Case Nelson -Chris Howey -Christoffer Buchholz -Daniel Wagner-Hall -Dave Cheney -Evan Phoenix -Francisco Souza -Hari haran -John C Barstow -Kelvin Fo -Ken-ichirou MATSUZAWA -Matt Layher -Nathan Youngman -Nickolai Zeldovich -Patrick -Paul Hammond -Pawel Knap -Pieter Droogendijk -Pursuit92 -Riku Voipio -Rob Figueiredo -Rodrigo Chiossi -Slawek Ligus -Soge Zhang -Tiffany Jernigan -Tilak Sharma -Tom Payne -Travis Cline -Tudor Golubenco -Vahe Khachikyan -Yukang -bronze1man -debrando -henrikedwards -铁哥 diff --git a/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md b/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md index be4d7ea..77f9593 100644 --- a/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md +++ b/vendor/github.com/fsnotify/fsnotify/CHANGELOG.md @@ -1,6 +1,159 @@ # Changelog -## v1.4.7 / 2018-01-09 +All notable changes to this project will be documented in this file. + +The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), +and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). + +## [Unreleased] + +Nothing yet. + +## [1.6.0] - 2022-10-13 + +This version of fsnotify needs Go 1.16 (this was already the case since 1.5.1, +but not documented). It also increases the minimum Linux version to 2.6.32. + +### Additions + +- all: add `Event.Has()` and `Op.Has()` ([#477]) + + This makes checking events a lot easier; for example: + + if event.Op&Write == Write && !(event.Op&Remove == Remove) { + } + + Becomes: + + if event.Has(Write) && !event.Has(Remove) { + } + +- all: add cmd/fsnotify ([#463]) + + A command-line utility for testing and some examples. + +### Changes and fixes + +- inotify: don't ignore events for files that don't exist ([#260], [#470]) + + Previously the inotify watcher would call `os.Lstat()` to check if a file + still exists before emitting events. + + This was inconsistent with other platforms and resulted in inconsistent event + reporting (e.g. when a file is quickly removed and re-created), and generally + a source of confusion. It was added in 2013 to fix a memory leak that no + longer exists. + +- all: return `ErrNonExistentWatch` when `Remove()` is called on a path that's + not watched ([#460]) + +- inotify: replace epoll() with non-blocking inotify ([#434]) + + Non-blocking inotify was not generally available at the time this library was + written in 2014, but now it is. As a result, the minimum Linux version is + bumped from 2.6.27 to 2.6.32. This hugely simplifies the code and is faster. + +- kqueue: don't check for events every 100ms ([#480]) + + The watcher would wake up every 100ms, even when there was nothing to do. Now + it waits until there is something to do. + +- macos: retry opening files on EINTR ([#475]) + +- kqueue: skip unreadable files ([#479]) + + kqueue requires a file descriptor for every file in a directory; this would + fail if a file was unreadable by the current user. Now these files are simply + skipped. + +- windows: fix renaming a watched directory if the parent is also watched ([#370]) + +- windows: increase buffer size from 4K to 64K ([#485]) + +- windows: close file handle on Remove() ([#288]) + +- kqueue: put pathname in the error if watching a file fails ([#471]) + +- inotify, windows: calling Close() more than once could race ([#465]) + +- kqueue: improve Close() performance ([#233]) + +- all: various documentation additions and clarifications. + +[#233]: https://github.com/fsnotify/fsnotify/pull/233 +[#260]: https://github.com/fsnotify/fsnotify/pull/260 +[#288]: https://github.com/fsnotify/fsnotify/pull/288 +[#370]: https://github.com/fsnotify/fsnotify/pull/370 +[#434]: https://github.com/fsnotify/fsnotify/pull/434 +[#460]: https://github.com/fsnotify/fsnotify/pull/460 +[#463]: https://github.com/fsnotify/fsnotify/pull/463 +[#465]: https://github.com/fsnotify/fsnotify/pull/465 +[#470]: https://github.com/fsnotify/fsnotify/pull/470 +[#471]: https://github.com/fsnotify/fsnotify/pull/471 +[#475]: https://github.com/fsnotify/fsnotify/pull/475 +[#477]: https://github.com/fsnotify/fsnotify/pull/477 +[#479]: https://github.com/fsnotify/fsnotify/pull/479 +[#480]: https://github.com/fsnotify/fsnotify/pull/480 +[#485]: https://github.com/fsnotify/fsnotify/pull/485 + +## [1.5.4] - 2022-04-25 + +* Windows: add missing defer to `Watcher.WatchList` [#447](https://github.com/fsnotify/fsnotify/pull/447) +* go.mod: use latest x/sys [#444](https://github.com/fsnotify/fsnotify/pull/444) +* Fix compilation for OpenBSD [#443](https://github.com/fsnotify/fsnotify/pull/443) + +## [1.5.3] - 2022-04-22 + +* This version is retracted. An incorrect branch is published accidentally [#445](https://github.com/fsnotify/fsnotify/issues/445) + +## [1.5.2] - 2022-04-21 + +* Add a feature to return the directories and files that are being monitored [#374](https://github.com/fsnotify/fsnotify/pull/374) +* Fix potential crash on windows if `raw.FileNameLength` exceeds `syscall.MAX_PATH` [#361](https://github.com/fsnotify/fsnotify/pull/361) +* Allow build on unsupported GOOS [#424](https://github.com/fsnotify/fsnotify/pull/424) +* Don't set `poller.fd` twice in `newFdPoller` [#406](https://github.com/fsnotify/fsnotify/pull/406) +* fix go vet warnings: call to `(*T).Fatalf` from a non-test goroutine [#416](https://github.com/fsnotify/fsnotify/pull/416) + +## [1.5.1] - 2021-08-24 + +* Revert Add AddRaw to not follow symlinks [#394](https://github.com/fsnotify/fsnotify/pull/394) + +## [1.5.0] - 2021-08-20 + +* Go: Increase minimum required version to Go 1.12 [#381](https://github.com/fsnotify/fsnotify/pull/381) +* Feature: Add AddRaw method which does not follow symlinks when adding a watch [#289](https://github.com/fsnotify/fsnotify/pull/298) +* Windows: Follow symlinks by default like on all other systems [#289](https://github.com/fsnotify/fsnotify/pull/289) +* CI: Use GitHub Actions for CI and cover go 1.12-1.17 + [#378](https://github.com/fsnotify/fsnotify/pull/378) + [#381](https://github.com/fsnotify/fsnotify/pull/381) + [#385](https://github.com/fsnotify/fsnotify/pull/385) +* Go 1.14+: Fix unsafe pointer conversion [#325](https://github.com/fsnotify/fsnotify/pull/325) + +## [1.4.9] - 2020-03-11 + +* Move example usage to the readme #329. This may resolve #328. + +## [1.4.8] - 2020-03-10 + +* CI: test more go versions (@nathany 1d13583d846ea9d66dcabbfefbfb9d8e6fb05216) +* Tests: Queued inotify events could have been read by the test before max_queued_events was hit (@matthias-stone #265) +* Tests: t.Fatalf -> t.Errorf in go routines (@gdey #266) +* CI: Less verbosity (@nathany #267) +* Tests: Darwin: Exchangedata is deprecated on 10.13 (@nathany #267) +* Tests: Check if channels are closed in the example (@alexeykazakov #244) +* CI: Only run golint on latest version of go and fix issues (@cpuguy83 #284) +* CI: Add windows to travis matrix (@cpuguy83 #284) +* Docs: Remover appveyor badge (@nathany 11844c0959f6fff69ba325d097fce35bd85a8e93) +* Linux: create epoll and pipe fds with close-on-exec (@JohannesEbke #219) +* Linux: open files with close-on-exec (@linxiulei #273) +* Docs: Plan to support fanotify (@nathany ab058b44498e8b7566a799372a39d150d9ea0119 ) +* Project: Add go.mod (@nathany #309) +* Project: Revise editor config (@nathany #309) +* Project: Update copyright for 2019 (@nathany #309) +* CI: Drop go1.8 from CI matrix (@nathany #309) +* Docs: Updating the FAQ section for supportability with NFS & FUSE filesystems (@Pratik32 4bf2d1fec78374803a39307bfb8d340688f4f28e ) + +## [1.4.7] - 2018-01-09 * BSD/macOS: Fix possible deadlock on closing the watcher on kqueue (thanks @nhooyr and @glycerine) * Tests: Fix missing verb on format string (thanks @rchiossi) @@ -10,62 +163,62 @@ * Linux: Properly handle inotify's IN_Q_OVERFLOW event (thanks @zeldovich) * Docs: replace references to OS X with macOS -## v1.4.2 / 2016-10-10 +## [1.4.2] - 2016-10-10 * Linux: use InotifyInit1 with IN_CLOEXEC to stop leaking a file descriptor to a child process when using fork/exec [#178](https://github.com/fsnotify/fsnotify/pull/178) (thanks @pattyshack) -## v1.4.1 / 2016-10-04 +## [1.4.1] - 2016-10-04 * Fix flaky inotify stress test on Linux [#177](https://github.com/fsnotify/fsnotify/pull/177) (thanks @pattyshack) -## v1.4.0 / 2016-10-01 +## [1.4.0] - 2016-10-01 * add a String() method to Event.Op [#165](https://github.com/fsnotify/fsnotify/pull/165) (thanks @oozie) -## v1.3.1 / 2016-06-28 +## [1.3.1] - 2016-06-28 * Windows: fix for double backslash when watching the root of a drive [#151](https://github.com/fsnotify/fsnotify/issues/151) (thanks @brunoqc) -## v1.3.0 / 2016-04-19 +## [1.3.0] - 2016-04-19 * Support linux/arm64 by [patching](https://go-review.googlesource.com/#/c/21971/) x/sys/unix and switching to to it from syscall (thanks @suihkulokki) [#135](https://github.com/fsnotify/fsnotify/pull/135) -## v1.2.10 / 2016-03-02 +## [1.2.10] - 2016-03-02 * Fix golint errors in windows.go [#121](https://github.com/fsnotify/fsnotify/pull/121) (thanks @tiffanyfj) -## v1.2.9 / 2016-01-13 +## [1.2.9] - 2016-01-13 kqueue: Fix logic for CREATE after REMOVE [#111](https://github.com/fsnotify/fsnotify/pull/111) (thanks @bep) -## v1.2.8 / 2015-12-17 +## [1.2.8] - 2015-12-17 * kqueue: fix race condition in Close [#105](https://github.com/fsnotify/fsnotify/pull/105) (thanks @djui for reporting the issue and @ppknap for writing a failing test) * inotify: fix race in test * enable race detection for continuous integration (Linux, Mac, Windows) -## v1.2.5 / 2015-10-17 +## [1.2.5] - 2015-10-17 * inotify: use epoll_create1 for arm64 support (requires Linux 2.6.27 or later) [#100](https://github.com/fsnotify/fsnotify/pull/100) (thanks @suihkulokki) * inotify: fix path leaks [#73](https://github.com/fsnotify/fsnotify/pull/73) (thanks @chamaken) * kqueue: watch for rename events on subdirectories [#83](https://github.com/fsnotify/fsnotify/pull/83) (thanks @guotie) * kqueue: avoid infinite loops from symlinks cycles [#101](https://github.com/fsnotify/fsnotify/pull/101) (thanks @illicitonion) -## v1.2.1 / 2015-10-14 +## [1.2.1] - 2015-10-14 * kqueue: don't watch named pipes [#98](https://github.com/fsnotify/fsnotify/pull/98) (thanks @evanphx) -## v1.2.0 / 2015-02-08 +## [1.2.0] - 2015-02-08 * inotify: use epoll to wake up readEvents [#66](https://github.com/fsnotify/fsnotify/pull/66) (thanks @PieterD) * inotify: closing watcher should now always shut down goroutine [#63](https://github.com/fsnotify/fsnotify/pull/63) (thanks @PieterD) * kqueue: close kqueue after removing watches, fixes [#59](https://github.com/fsnotify/fsnotify/issues/59) -## v1.1.1 / 2015-02-05 +## [1.1.1] - 2015-02-05 * inotify: Retry read on EINTR [#61](https://github.com/fsnotify/fsnotify/issues/61) (thanks @PieterD) -## v1.1.0 / 2014-12-12 +## [1.1.0] - 2014-12-12 * kqueue: rework internals [#43](https://github.com/fsnotify/fsnotify/pull/43) * add low-level functions @@ -77,22 +230,22 @@ kqueue: Fix logic for CREATE after REMOVE [#111](https://github.com/fsnotify/fsn * kqueue: fix regression in rework causing subdirectories to be watched [#48](https://github.com/fsnotify/fsnotify/issues/48) * kqueue: cleanup internal watch before sending remove event [#51](https://github.com/fsnotify/fsnotify/issues/51) -## v1.0.4 / 2014-09-07 +## [1.0.4] - 2014-09-07 * kqueue: add dragonfly to the build tags. * Rename source code files, rearrange code so exported APIs are at the top. * Add done channel to example code. [#37](https://github.com/fsnotify/fsnotify/pull/37) (thanks @chenyukang) -## v1.0.3 / 2014-08-19 +## [1.0.3] - 2014-08-19 * [Fix] Windows MOVED_TO now translates to Create like on BSD and Linux. [#36](https://github.com/fsnotify/fsnotify/issues/36) -## v1.0.2 / 2014-08-17 +## [1.0.2] - 2014-08-17 * [Fix] Missing create events on macOS. [#14](https://github.com/fsnotify/fsnotify/issues/14) (thanks @zhsso) * [Fix] Make ./path and path equivalent. (thanks @zhsso) -## v1.0.0 / 2014-08-15 +## [1.0.0] - 2014-08-15 * [API] Remove AddWatch on Windows, use Add. * Improve documentation for exported identifiers. [#30](https://github.com/fsnotify/fsnotify/issues/30) @@ -146,51 +299,51 @@ kqueue: Fix logic for CREATE after REMOVE [#111](https://github.com/fsnotify/fsn * no tests for the current implementation * not fully implemented on Windows [#93](https://github.com/howeyc/fsnotify/issues/93#issuecomment-39285195) -## v0.9.3 / 2014-12-31 +## [0.9.3] - 2014-12-31 * kqueue: cleanup internal watch before sending remove event [#51](https://github.com/fsnotify/fsnotify/issues/51) -## v0.9.2 / 2014-08-17 +## [0.9.2] - 2014-08-17 * [Backport] Fix missing create events on macOS. [#14](https://github.com/fsnotify/fsnotify/issues/14) (thanks @zhsso) -## v0.9.1 / 2014-06-12 +## [0.9.1] - 2014-06-12 * Fix data race on kevent buffer (thanks @tilaks) [#98](https://github.com/howeyc/fsnotify/pull/98) -## v0.9.0 / 2014-01-17 +## [0.9.0] - 2014-01-17 * IsAttrib() for events that only concern a file's metadata [#79][] (thanks @abustany) * [Fix] kqueue: fix deadlock [#77][] (thanks @cespare) * [NOTICE] Development has moved to `code.google.com/p/go.exp/fsnotify` in preparation for inclusion in the Go standard library. -## v0.8.12 / 2013-11-13 +## [0.8.12] - 2013-11-13 * [API] Remove FD_SET and friends from Linux adapter -## v0.8.11 / 2013-11-02 +## [0.8.11] - 2013-11-02 * [Doc] Add Changelog [#72][] (thanks @nathany) * [Doc] Spotlight and double modify events on macOS [#62][] (reported by @paulhammond) -## v0.8.10 / 2013-10-19 +## [0.8.10] - 2013-10-19 * [Fix] kqueue: remove file watches when parent directory is removed [#71][] (reported by @mdwhatcott) * [Fix] kqueue: race between Close and readEvents [#70][] (reported by @bernerdschaefer) * [Doc] specify OS-specific limits in README (thanks @debrando) -## v0.8.9 / 2013-09-08 +## [0.8.9] - 2013-09-08 * [Doc] Contributing (thanks @nathany) * [Doc] update package path in example code [#63][] (thanks @paulhammond) * [Doc] GoCI badge in README (Linux only) [#60][] * [Doc] Cross-platform testing with Vagrant [#59][] (thanks @nathany) -## v0.8.8 / 2013-06-17 +## [0.8.8] - 2013-06-17 * [Fix] Windows: handle `ERROR_MORE_DATA` on Windows [#49][] (thanks @jbowtie) -## v0.8.7 / 2013-06-03 +## [0.8.7] - 2013-06-03 * [API] Make syscall flags internal * [Fix] inotify: ignore event changes @@ -198,74 +351,74 @@ kqueue: Fix logic for CREATE after REMOVE [#111](https://github.com/fsnotify/fsn * [Fix] tests on Windows * lower case error messages -## v0.8.6 / 2013-05-23 +## [0.8.6] - 2013-05-23 * kqueue: Use EVT_ONLY flag on Darwin * [Doc] Update README with full example -## v0.8.5 / 2013-05-09 +## [0.8.5] - 2013-05-09 * [Fix] inotify: allow monitoring of "broken" symlinks (thanks @tsg) -## v0.8.4 / 2013-04-07 +## [0.8.4] - 2013-04-07 * [Fix] kqueue: watch all file events [#40][] (thanks @ChrisBuchholz) -## v0.8.3 / 2013-03-13 +## [0.8.3] - 2013-03-13 * [Fix] inoitfy/kqueue memory leak [#36][] (reported by @nbkolchin) * [Fix] kqueue: use fsnFlags for watching a directory [#33][] (reported by @nbkolchin) -## v0.8.2 / 2013-02-07 +## [0.8.2] - 2013-02-07 * [Doc] add Authors * [Fix] fix data races for map access [#29][] (thanks @fsouza) -## v0.8.1 / 2013-01-09 +## [0.8.1] - 2013-01-09 * [Fix] Windows path separators * [Doc] BSD License -## v0.8.0 / 2012-11-09 +## [0.8.0] - 2012-11-09 * kqueue: directory watching improvements (thanks @vmirage) * inotify: add `IN_MOVED_TO` [#25][] (requested by @cpisto) * [Fix] kqueue: deleting watched directory [#24][] (reported by @jakerr) -## v0.7.4 / 2012-10-09 +## [0.7.4] - 2012-10-09 * [Fix] inotify: fixes from https://codereview.appspot.com/5418045/ (ugorji) * [Fix] kqueue: preserve watch flags when watching for delete [#21][] (reported by @robfig) * [Fix] kqueue: watch the directory even if it isn't a new watch (thanks @robfig) * [Fix] kqueue: modify after recreation of file -## v0.7.3 / 2012-09-27 +## [0.7.3] - 2012-09-27 * [Fix] kqueue: watch with an existing folder inside the watched folder (thanks @vmirage) * [Fix] kqueue: no longer get duplicate CREATE events -## v0.7.2 / 2012-09-01 +## [0.7.2] - 2012-09-01 * kqueue: events for created directories -## v0.7.1 / 2012-07-14 +## [0.7.1] - 2012-07-14 * [Fix] for renaming files -## v0.7.0 / 2012-07-02 +## [0.7.0] - 2012-07-02 * [Feature] FSNotify flags * [Fix] inotify: Added file name back to event path -## v0.6.0 / 2012-06-06 +## [0.6.0] - 2012-06-06 * kqueue: watch files after directory created (thanks @tmc) -## v0.5.1 / 2012-05-22 +## [0.5.1] - 2012-05-22 * [Fix] inotify: remove all watches before Close() -## v0.5.0 / 2012-05-03 +## [0.5.0] - 2012-05-03 * [API] kqueue: return errors during watch instead of sending over channel * kqueue: match symlink behavior on Linux @@ -273,22 +426,22 @@ kqueue: Fix logic for CREATE after REMOVE [#111](https://github.com/fsnotify/fsn * [Fix] kqueue: handle EINTR (reported by @robfig) * [Doc] Godoc example [#1][] (thanks @davecheney) -## v0.4.0 / 2012-03-30 +## [0.4.0] - 2012-03-30 * Go 1 released: build with go tool * [Feature] Windows support using winfsnotify * Windows does not have attribute change notifications * Roll attribute notifications into IsModify -## v0.3.0 / 2012-02-19 +## [0.3.0] - 2012-02-19 * kqueue: add files when watch directory -## v0.2.0 / 2011-12-30 +## [0.2.0] - 2011-12-30 * update to latest Go weekly code -## v0.1.0 / 2011-10-19 +## [0.1.0] - 2011-10-19 * kqueue: add watch on file creation to match inotify * kqueue: create file event diff --git a/vendor/github.com/fsnotify/fsnotify/CONTRIBUTING.md b/vendor/github.com/fsnotify/fsnotify/CONTRIBUTING.md index 828a60b..ea37975 100644 --- a/vendor/github.com/fsnotify/fsnotify/CONTRIBUTING.md +++ b/vendor/github.com/fsnotify/fsnotify/CONTRIBUTING.md @@ -1,77 +1,26 @@ -# Contributing +Thank you for your interest in contributing to fsnotify! We try to review and +merge PRs in a reasonable timeframe, but please be aware that: -## Issues +- To avoid "wasted" work, please discus changes on the issue tracker first. You + can just send PRs, but they may end up being rejected for one reason or the + other. -* Request features and report bugs using the [GitHub Issue Tracker](https://github.com/fsnotify/fsnotify/issues). -* Please indicate the platform you are using fsnotify on. -* A code example to reproduce the problem is appreciated. +- fsnotify is a cross-platform library, and changes must work reasonably well on + all supported platforms. -## Pull Requests +- Changes will need to be compatible; old code should still compile, and the + runtime behaviour can't change in ways that are likely to lead to problems for + users. -### Contributor License Agreement +Testing +------- +Just `go test ./...` runs all the tests; the CI runs this on all supported +platforms. Testing different platforms locally can be done with something like +[goon] or [Vagrant], but this isn't super-easy to set up at the moment. -fsnotify is derived from code in the [golang.org/x/exp](https://godoc.org/golang.org/x/exp) package and it may be included [in the standard library](https://github.com/fsnotify/fsnotify/issues/1) in the future. Therefore fsnotify carries the same [LICENSE](https://github.com/fsnotify/fsnotify/blob/master/LICENSE) as Go. Contributors retain their copyright, so you need to fill out a short form before we can accept your contribution: [Google Individual Contributor License Agreement](https://developers.google.com/open-source/cla/individual). +Use the `-short` flag to make the "stress test" run faster. -Please indicate that you have signed the CLA in your pull request. -### How fsnotify is Developed - -* Development is done on feature branches. -* Tests are run on BSD, Linux, macOS and Windows. -* Pull requests are reviewed and [applied to master][am] using [hub][]. - * Maintainers may modify or squash commits rather than asking contributors to. -* To issue a new release, the maintainers will: - * Update the CHANGELOG - * Tag a version, which will become available through gopkg.in. - -### How to Fork - -For smooth sailing, always use the original import path. Installing with `go get` makes this easy. - -1. Install from GitHub (`go get -u github.com/fsnotify/fsnotify`) -2. Create your feature branch (`git checkout -b my-new-feature`) -3. Ensure everything works and the tests pass (see below) -4. Commit your changes (`git commit -am 'Add some feature'`) - -Contribute upstream: - -1. Fork fsnotify on GitHub -2. Add your remote (`git remote add fork git@github.com:mycompany/repo.git`) -3. Push to the branch (`git push fork my-new-feature`) -4. Create a new Pull Request on GitHub - -This workflow is [thoroughly explained by Katrina Owen](https://splice.com/blog/contributing-open-source-git-repositories-go/). - -### Testing - -fsnotify uses build tags to compile different code on Linux, BSD, macOS, and Windows. - -Before doing a pull request, please do your best to test your changes on multiple platforms, and list which platforms you were able/unable to test on. - -To aid in cross-platform testing there is a Vagrantfile for Linux and BSD. - -* Install [Vagrant](http://www.vagrantup.com/) and [VirtualBox](https://www.virtualbox.org/) -* Setup [Vagrant Gopher](https://github.com/nathany/vagrant-gopher) in your `src` folder. -* Run `vagrant up` from the project folder. You can also setup just one box with `vagrant up linux` or `vagrant up bsd` (note: the BSD box doesn't support Windows hosts at this time, and NFS may prompt for your host OS password) -* Once setup, you can run the test suite on a given OS with a single command `vagrant ssh linux -c 'cd fsnotify/fsnotify; go test'`. -* When you're done, you will want to halt or destroy the Vagrant boxes. - -Notice: fsnotify file system events won't trigger in shared folders. The tests get around this limitation by using the /tmp directory. - -Right now there is no equivalent solution for Windows and macOS, but there are Windows VMs [freely available from Microsoft](http://www.modern.ie/en-us/virtualization-tools#downloads). - -### Maintainers - -Help maintaining fsnotify is welcome. To be a maintainer: - -* Submit a pull request and sign the CLA as above. -* You must be able to run the test suite on Mac, Windows, Linux and BSD. - -To keep master clean, the fsnotify project uses the "apply mail" workflow outlined in Nathaniel Talbott's post ["Merge pull request" Considered Harmful][am]. This requires installing [hub][]. - -All code changes should be internal pull requests. - -Releases are tagged using [Semantic Versioning](http://semver.org/). - -[hub]: https://github.com/github/hub -[am]: http://blog.spreedly.com/2014/06/24/merge-pull-request-considered-harmful/#.VGa5yZPF_Zs +[goon]: https://github.com/arp242/goon +[Vagrant]: https://www.vagrantup.com/ +[integration_test.go]: /integration_test.go diff --git a/vendor/github.com/fsnotify/fsnotify/LICENSE b/vendor/github.com/fsnotify/fsnotify/LICENSE index e180c8f..fb03ade 100644 --- a/vendor/github.com/fsnotify/fsnotify/LICENSE +++ b/vendor/github.com/fsnotify/fsnotify/LICENSE @@ -1,28 +1,25 @@ -Copyright (c) 2012 The Go Authors. All rights reserved. -Copyright (c) 2012-2019 fsnotify Authors. All rights reserved. +Copyright © 2012 The Go Authors. All rights reserved. +Copyright © fsnotify Authors. All rights reserved. -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: +Redistribution and use in source and binary forms, with or without modification, +are permitted provided that the following conditions are met: - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. +* Redistributions of source code must retain the above copyright notice, this + list of conditions and the following disclaimer. +* Redistributions in binary form must reproduce the above copyright notice, this + list of conditions and the following disclaimer in the documentation and/or + other materials provided with the distribution. +* Neither the name of Google Inc. nor the names of its contributors may be used + to endorse or promote products derived from this software without specific + prior written permission. -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND +ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED +WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE +DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR +ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES +(INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; +LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON +ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS +SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/fsnotify/fsnotify/README.md b/vendor/github.com/fsnotify/fsnotify/README.md index b2629e5..d4e6080 100644 --- a/vendor/github.com/fsnotify/fsnotify/README.md +++ b/vendor/github.com/fsnotify/fsnotify/README.md @@ -1,130 +1,161 @@ -# File system notifications for Go +fsnotify is a Go library to provide cross-platform filesystem notifications on +Windows, Linux, macOS, and BSD systems. -[![GoDoc](https://godoc.org/github.com/fsnotify/fsnotify?status.svg)](https://godoc.org/github.com/fsnotify/fsnotify) [![Go Report Card](https://goreportcard.com/badge/github.com/fsnotify/fsnotify)](https://goreportcard.com/report/github.com/fsnotify/fsnotify) +Go 1.16 or newer is required; the full documentation is at +https://pkg.go.dev/github.com/fsnotify/fsnotify -fsnotify utilizes [golang.org/x/sys](https://godoc.org/golang.org/x/sys) rather than `syscall` from the standard library. Ensure you have the latest version installed by running: +**It's best to read the documentation at pkg.go.dev, as it's pinned to the last +released version, whereas this README is for the last development version which +may include additions/changes.** -```console -go get -u golang.org/x/sys/... -``` - -Cross platform: Windows, Linux, BSD and macOS. - -| Adapter | OS | Status | -| --------------------- | -------------------------------- | ------------------------------------------------------------------------------------------------------------------------------- | -| inotify | Linux 2.6.27 or later, Android\* | Supported [![Build Status](https://travis-ci.org/fsnotify/fsnotify.svg?branch=master)](https://travis-ci.org/fsnotify/fsnotify) | -| kqueue | BSD, macOS, iOS\* | Supported [![Build Status](https://travis-ci.org/fsnotify/fsnotify.svg?branch=master)](https://travis-ci.org/fsnotify/fsnotify) | -| ReadDirectoryChangesW | Windows | Supported [![Build Status](https://travis-ci.org/fsnotify/fsnotify.svg?branch=master)](https://travis-ci.org/fsnotify/fsnotify) | -| FSEvents | macOS | [Planned](https://github.com/fsnotify/fsnotify/issues/11) | -| FEN | Solaris 11 | [In Progress](https://github.com/fsnotify/fsnotify/issues/12) | -| fanotify | Linux 2.6.37+ | [Planned](https://github.com/fsnotify/fsnotify/issues/114) | -| USN Journals | Windows | [Maybe](https://github.com/fsnotify/fsnotify/issues/53) | -| Polling | *All* | [Maybe](https://github.com/fsnotify/fsnotify/issues/9) | - -\* Android and iOS are untested. - -Please see [the documentation](https://godoc.org/github.com/fsnotify/fsnotify) and consult the [FAQ](#faq) for usage information. - -## API stability +--- -fsnotify is a fork of [howeyc/fsnotify](https://godoc.org/github.com/howeyc/fsnotify) with a new API as of v1.0. The API is based on [this design document](http://goo.gl/MrYxyA). +Platform support: -All [releases](https://github.com/fsnotify/fsnotify/releases) are tagged based on [Semantic Versioning](http://semver.org/). Further API changes are [planned](https://github.com/fsnotify/fsnotify/milestones), and will be tagged with a new major revision number. +| Adapter | OS | Status | +| --------------------- | ---------------| -------------------------------------------------------------| +| inotify | Linux 2.6.32+ | Supported | +| kqueue | BSD, macOS | Supported | +| ReadDirectoryChangesW | Windows | Supported | +| FSEvents | macOS | [Planned](https://github.com/fsnotify/fsnotify/issues/11) | +| FEN | Solaris 11 | [In Progress](https://github.com/fsnotify/fsnotify/pull/371) | +| fanotify | Linux 5.9+ | [Maybe](https://github.com/fsnotify/fsnotify/issues/114) | +| USN Journals | Windows | [Maybe](https://github.com/fsnotify/fsnotify/issues/53) | +| Polling | *All* | [Maybe](https://github.com/fsnotify/fsnotify/issues/9) | -Go 1.6 supports dependencies located in the `vendor/` folder. Unless you are creating a library, it is recommended that you copy fsnotify into `vendor/github.com/fsnotify/fsnotify` within your project, and likewise for `golang.org/x/sys`. +Linux and macOS should include Android and iOS, but these are currently untested. -## Usage +Usage +----- +A basic example: ```go package main import ( - "log" + "log" - "github.com/fsnotify/fsnotify" + "github.com/fsnotify/fsnotify" ) func main() { - watcher, err := fsnotify.NewWatcher() - if err != nil { - log.Fatal(err) - } - defer watcher.Close() - - done := make(chan bool) - go func() { - for { - select { - case event, ok := <-watcher.Events: - if !ok { - return - } - log.Println("event:", event) - if event.Op&fsnotify.Write == fsnotify.Write { - log.Println("modified file:", event.Name) - } - case err, ok := <-watcher.Errors: - if !ok { - return - } - log.Println("error:", err) - } - } - }() - - err = watcher.Add("/tmp/foo") - if err != nil { - log.Fatal(err) - } - <-done + // Create new watcher. + watcher, err := fsnotify.NewWatcher() + if err != nil { + log.Fatal(err) + } + defer watcher.Close() + + // Start listening for events. + go func() { + for { + select { + case event, ok := <-watcher.Events: + if !ok { + return + } + log.Println("event:", event) + if event.Has(fsnotify.Write) { + log.Println("modified file:", event.Name) + } + case err, ok := <-watcher.Errors: + if !ok { + return + } + log.Println("error:", err) + } + } + }() + + // Add a path. + err = watcher.Add("/tmp") + if err != nil { + log.Fatal(err) + } + + // Block main goroutine forever. + <-make(chan struct{}) } ``` -## Contributing +Some more examples can be found in [cmd/fsnotify](cmd/fsnotify), which can be +run with: -Please refer to [CONTRIBUTING][] before opening an issue or pull request. + % go run ./cmd/fsnotify -## Example +FAQ +--- +### Will a file still be watched when it's moved to another directory? +No, not unless you are watching the location it was moved to. -See [example_test.go](https://github.com/fsnotify/fsnotify/blob/master/example_test.go). +### Are subdirectories watched too? +No, you must add watches for any directory you want to watch (a recursive +watcher is on the roadmap: [#18]). -## FAQ +[#18]: https://github.com/fsnotify/fsnotify/issues/18 -**When a file is moved to another directory is it still being watched?** +### Do I have to watch the Error and Event channels in a goroutine? +As of now, yes (you can read both channels in the same goroutine using `select`, +you don't need a separate goroutine for both channels; see the example). -No (it shouldn't be, unless you are watching where it was moved to). +### Why don't notifications work with NFS, SMB, FUSE, /proc, or /sys? +fsnotify requires support from underlying OS to work. The current NFS and SMB +protocols does not provide network level support for file notifications, and +neither do the /proc and /sys virtual filesystems. -**When I watch a directory, are all subdirectories watched as well?** +This could be fixed with a polling watcher ([#9]), but it's not yet implemented. -No, you must add watches for any directory you want to watch (a recursive watcher is on the roadmap [#18][]). +[#9]: https://github.com/fsnotify/fsnotify/issues/9 -**Do I have to watch the Error and Event channels in a separate goroutine?** +Platform-specific notes +----------------------- +### Linux +When a file is removed a REMOVE event won't be emitted until all file +descriptors are closed; it will emit a CHMOD instead: -As of now, yes. Looking into making this single-thread friendly (see [howeyc #7][#7]) + fp := os.Open("file") + os.Remove("file") // CHMOD + fp.Close() // REMOVE -**Why am I receiving multiple events for the same file on OS X?** +This is the event that inotify sends, so not much can be changed about this. -Spotlight indexing on OS X can result in multiple events (see [howeyc #62][#62]). A temporary workaround is to add your folder(s) to the *Spotlight Privacy settings* until we have a native FSEvents implementation (see [#11][]). +The `fs.inotify.max_user_watches` sysctl variable specifies the upper limit for +the number of watches per user, and `fs.inotify.max_user_instances` specifies +the maximum number of inotify instances per user. Every Watcher you create is an +"instance", and every path you add is a "watch". -**How many files can be watched at once?** +These are also exposed in `/proc` as `/proc/sys/fs/inotify/max_user_watches` and +`/proc/sys/fs/inotify/max_user_instances` -There are OS-specific limits as to how many watches can be created: -* Linux: /proc/sys/fs/inotify/max_user_watches contains the limit, reaching this limit results in a "no space left on device" error. -* BSD / OSX: sysctl variables "kern.maxfiles" and "kern.maxfilesperproc", reaching these limits results in a "too many open files" error. +To increase them you can use `sysctl` or write the value to proc file: -**Why don't notifications work with NFS filesystems or filesystem in userspace (FUSE)?** + # The default values on Linux 5.18 + sysctl fs.inotify.max_user_watches=124983 + sysctl fs.inotify.max_user_instances=128 -fsnotify requires support from underlying OS to work. The current NFS protocol does not provide network level support for file notifications. +To make the changes persist on reboot edit `/etc/sysctl.conf` or +`/usr/lib/sysctl.d/50-default.conf` (details differ per Linux distro; check your +distro's documentation): -[#62]: https://github.com/howeyc/fsnotify/issues/62 -[#18]: https://github.com/fsnotify/fsnotify/issues/18 -[#11]: https://github.com/fsnotify/fsnotify/issues/11 -[#7]: https://github.com/howeyc/fsnotify/issues/7 + fs.inotify.max_user_watches=124983 + fs.inotify.max_user_instances=128 -[contributing]: https://github.com/fsnotify/fsnotify/blob/master/CONTRIBUTING.md +Reaching the limit will result in a "no space left on device" or "too many open +files" error. -## Related Projects +### kqueue (macOS, all BSD systems) +kqueue requires opening a file descriptor for every file that's being watched; +so if you're watching a directory with five files then that's six file +descriptors. You will run in to your system's "max open files" limit faster on +these platforms. -* [notify](https://github.com/rjeczalik/notify) -* [fsevents](https://github.com/fsnotify/fsevents) +The sysctl variables `kern.maxfiles` and `kern.maxfilesperproc` can be used to +control the maximum number of open files. +### macOS +Spotlight indexing on macOS can result in multiple events (see [#15]). A temporary +workaround is to add your folder(s) to the *Spotlight Privacy settings* until we +have a native FSEvents implementation (see [#11]). + +[#11]: https://github.com/fsnotify/fsnotify/issues/11 +[#15]: https://github.com/fsnotify/fsnotify/issues/15 diff --git a/vendor/github.com/fsnotify/fsnotify/backend_fen.go b/vendor/github.com/fsnotify/fsnotify/backend_fen.go new file mode 100644 index 0000000..1a95ad8 --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/backend_fen.go @@ -0,0 +1,162 @@ +//go:build solaris +// +build solaris + +package fsnotify + +import ( + "errors" +) + +// Watcher watches a set of paths, delivering events on a channel. +// +// A watcher should not be copied (e.g. pass it by pointer, rather than by +// value). +// +// # Linux notes +// +// When a file is removed a Remove event won't be emitted until all file +// descriptors are closed, and deletes will always emit a Chmod. For example: +// +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove +// +// This is the event that inotify sends, so not much can be changed about this. +// +// The fs.inotify.max_user_watches sysctl variable specifies the upper limit +// for the number of watches per user, and fs.inotify.max_user_instances +// specifies the maximum number of inotify instances per user. Every Watcher you +// create is an "instance", and every path you add is a "watch". +// +// These are also exposed in /proc as /proc/sys/fs/inotify/max_user_watches and +// /proc/sys/fs/inotify/max_user_instances +// +// To increase them you can use sysctl or write the value to the /proc file: +// +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 +// +// To make the changes persist on reboot edit /etc/sysctl.conf or +// /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check +// your distro's documentation): +// +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 +// +// Reaching the limit will result in a "no space left on device" or "too many open +// files" error. +// +// # kqueue notes (macOS, BSD) +// +// kqueue requires opening a file descriptor for every file that's being watched; +// so if you're watching a directory with five files then that's six file +// descriptors. You will run in to your system's "max open files" limit faster on +// these platforms. +// +// The sysctl variables kern.maxfiles and kern.maxfilesperproc can be used to +// control the maximum number of open files, as well as /etc/login.conf on BSD +// systems. +// +// # macOS notes +// +// Spotlight indexing on macOS can result in multiple events (see [#15]). A +// temporary workaround is to add your folder(s) to the "Spotlight Privacy +// Settings" until we have a native FSEvents implementation (see [#11]). +// +// [#11]: https://github.com/fsnotify/fsnotify/issues/11 +// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +type Watcher struct { + // Events sends the filesystem change events. + // + // fsnotify can send the following events; a "path" here can refer to a + // file, directory, symbolic link, or special file like a FIFO. + // + // fsnotify.Create A new path was created; this may be followed by one + // or more Write events if data also gets written to a + // file. + // + // fsnotify.Remove A path was removed. + // + // fsnotify.Rename A path was renamed. A rename is always sent with the + // old path as Event.Name, and a Create event will be + // sent with the new name. Renames are only sent for + // paths that are currently watched; e.g. moving an + // unmonitored file into a monitored directory will + // show up as just a Create. Similarly, renaming a file + // to outside a monitored directory will show up as + // only a Rename. + // + // fsnotify.Write A file or named pipe was written to. A Truncate will + // also trigger a Write. A single "write action" + // initiated by the user may show up as one or multiple + // writes, depending on when the system syncs things to + // disk. For example when compiling a large Go program + // you may get hundreds of Write events, so you + // probably want to wait until you've stopped receiving + // them (see the dedup example in cmd/fsnotify). + // + // fsnotify.Chmod Attributes were changed. On Linux this is also sent + // when a file is removed (or more accurately, when a + // link to an inode is removed). On kqueue it's sent + // and on kqueue when a file is truncated. On Windows + // it's never sent. + Events chan Event + + // Errors sends any errors. + Errors chan error +} + +// NewWatcher creates a new Watcher. +func NewWatcher() (*Watcher, error) { + return nil, errors.New("FEN based watcher not yet supported for fsnotify\n") +} + +// Close removes all watches and closes the events channel. +func (w *Watcher) Close() error { + return nil +} + +// Add starts monitoring the path for changes. +// +// A path can only be watched once; attempting to watch it more than once will +// return an error. Paths that do not yet exist on the filesystem cannot be +// added. A watch will be automatically removed if the path is deleted. +// +// A path will remain watched if it gets renamed to somewhere else on the same +// filesystem, but the monitor will get removed if the path gets deleted and +// re-created, or if it's moved to a different filesystem. +// +// Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special +// filesystems (/proc, /sys, etc.) generally don't work. +// +// # Watching directories +// +// All files in a directory are monitored, including new files that are created +// after the watcher is started. Subdirectories are not watched (i.e. it's +// non-recursive). +// +// # Watching files +// +// Watching individual files (rather than directories) is generally not +// recommended as many tools update files atomically. Instead of "just" writing +// to the file a temporary file will be written to first, and if successful the +// temporary file is moved to to destination removing the original, or some +// variant thereof. The watcher on the original file is now lost, as it no +// longer exists. +// +// Instead, watch the parent directory and use Event.Name to filter out files +// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. +func (w *Watcher) Add(name string) error { + return nil +} + +// Remove stops monitoring the path for changes. +// +// Directories are always removed non-recursively. For example, if you added +// /tmp/dir and /tmp/dir/subdir then you will need to remove both. +// +// Removing a path that has not yet been added returns [ErrNonExistentWatch]. +func (w *Watcher) Remove(name string) error { + return nil +} diff --git a/vendor/github.com/fsnotify/fsnotify/backend_inotify.go b/vendor/github.com/fsnotify/fsnotify/backend_inotify.go new file mode 100644 index 0000000..54c77fb --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/backend_inotify.go @@ -0,0 +1,459 @@ +//go:build linux +// +build linux + +package fsnotify + +import ( + "errors" + "fmt" + "io" + "os" + "path/filepath" + "strings" + "sync" + "unsafe" + + "golang.org/x/sys/unix" +) + +// Watcher watches a set of paths, delivering events on a channel. +// +// A watcher should not be copied (e.g. pass it by pointer, rather than by +// value). +// +// # Linux notes +// +// When a file is removed a Remove event won't be emitted until all file +// descriptors are closed, and deletes will always emit a Chmod. For example: +// +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove +// +// This is the event that inotify sends, so not much can be changed about this. +// +// The fs.inotify.max_user_watches sysctl variable specifies the upper limit +// for the number of watches per user, and fs.inotify.max_user_instances +// specifies the maximum number of inotify instances per user. Every Watcher you +// create is an "instance", and every path you add is a "watch". +// +// These are also exposed in /proc as /proc/sys/fs/inotify/max_user_watches and +// /proc/sys/fs/inotify/max_user_instances +// +// To increase them you can use sysctl or write the value to the /proc file: +// +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 +// +// To make the changes persist on reboot edit /etc/sysctl.conf or +// /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check +// your distro's documentation): +// +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 +// +// Reaching the limit will result in a "no space left on device" or "too many open +// files" error. +// +// # kqueue notes (macOS, BSD) +// +// kqueue requires opening a file descriptor for every file that's being watched; +// so if you're watching a directory with five files then that's six file +// descriptors. You will run in to your system's "max open files" limit faster on +// these platforms. +// +// The sysctl variables kern.maxfiles and kern.maxfilesperproc can be used to +// control the maximum number of open files, as well as /etc/login.conf on BSD +// systems. +// +// # macOS notes +// +// Spotlight indexing on macOS can result in multiple events (see [#15]). A +// temporary workaround is to add your folder(s) to the "Spotlight Privacy +// Settings" until we have a native FSEvents implementation (see [#11]). +// +// [#11]: https://github.com/fsnotify/fsnotify/issues/11 +// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +type Watcher struct { + // Events sends the filesystem change events. + // + // fsnotify can send the following events; a "path" here can refer to a + // file, directory, symbolic link, or special file like a FIFO. + // + // fsnotify.Create A new path was created; this may be followed by one + // or more Write events if data also gets written to a + // file. + // + // fsnotify.Remove A path was removed. + // + // fsnotify.Rename A path was renamed. A rename is always sent with the + // old path as Event.Name, and a Create event will be + // sent with the new name. Renames are only sent for + // paths that are currently watched; e.g. moving an + // unmonitored file into a monitored directory will + // show up as just a Create. Similarly, renaming a file + // to outside a monitored directory will show up as + // only a Rename. + // + // fsnotify.Write A file or named pipe was written to. A Truncate will + // also trigger a Write. A single "write action" + // initiated by the user may show up as one or multiple + // writes, depending on when the system syncs things to + // disk. For example when compiling a large Go program + // you may get hundreds of Write events, so you + // probably want to wait until you've stopped receiving + // them (see the dedup example in cmd/fsnotify). + // + // fsnotify.Chmod Attributes were changed. On Linux this is also sent + // when a file is removed (or more accurately, when a + // link to an inode is removed). On kqueue it's sent + // and on kqueue when a file is truncated. On Windows + // it's never sent. + Events chan Event + + // Errors sends any errors. + Errors chan error + + // Store fd here as os.File.Read() will no longer return on close after + // calling Fd(). See: https://github.com/golang/go/issues/26439 + fd int + mu sync.Mutex // Map access + inotifyFile *os.File + watches map[string]*watch // Map of inotify watches (key: path) + paths map[int]string // Map of watched paths (key: watch descriptor) + done chan struct{} // Channel for sending a "quit message" to the reader goroutine + doneResp chan struct{} // Channel to respond to Close +} + +// NewWatcher creates a new Watcher. +func NewWatcher() (*Watcher, error) { + // Create inotify fd + // Need to set the FD to nonblocking mode in order for SetDeadline methods to work + // Otherwise, blocking i/o operations won't terminate on close + fd, errno := unix.InotifyInit1(unix.IN_CLOEXEC | unix.IN_NONBLOCK) + if fd == -1 { + return nil, errno + } + + w := &Watcher{ + fd: fd, + inotifyFile: os.NewFile(uintptr(fd), ""), + watches: make(map[string]*watch), + paths: make(map[int]string), + Events: make(chan Event), + Errors: make(chan error), + done: make(chan struct{}), + doneResp: make(chan struct{}), + } + + go w.readEvents() + return w, nil +} + +// Returns true if the event was sent, or false if watcher is closed. +func (w *Watcher) sendEvent(e Event) bool { + select { + case w.Events <- e: + return true + case <-w.done: + } + return false +} + +// Returns true if the error was sent, or false if watcher is closed. +func (w *Watcher) sendError(err error) bool { + select { + case w.Errors <- err: + return true + case <-w.done: + return false + } +} + +func (w *Watcher) isClosed() bool { + select { + case <-w.done: + return true + default: + return false + } +} + +// Close removes all watches and closes the events channel. +func (w *Watcher) Close() error { + w.mu.Lock() + if w.isClosed() { + w.mu.Unlock() + return nil + } + + // Send 'close' signal to goroutine, and set the Watcher to closed. + close(w.done) + w.mu.Unlock() + + // Causes any blocking reads to return with an error, provided the file + // still supports deadline operations. + err := w.inotifyFile.Close() + if err != nil { + return err + } + + // Wait for goroutine to close + <-w.doneResp + + return nil +} + +// Add starts monitoring the path for changes. +// +// A path can only be watched once; attempting to watch it more than once will +// return an error. Paths that do not yet exist on the filesystem cannot be +// added. A watch will be automatically removed if the path is deleted. +// +// A path will remain watched if it gets renamed to somewhere else on the same +// filesystem, but the monitor will get removed if the path gets deleted and +// re-created, or if it's moved to a different filesystem. +// +// Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special +// filesystems (/proc, /sys, etc.) generally don't work. +// +// # Watching directories +// +// All files in a directory are monitored, including new files that are created +// after the watcher is started. Subdirectories are not watched (i.e. it's +// non-recursive). +// +// # Watching files +// +// Watching individual files (rather than directories) is generally not +// recommended as many tools update files atomically. Instead of "just" writing +// to the file a temporary file will be written to first, and if successful the +// temporary file is moved to to destination removing the original, or some +// variant thereof. The watcher on the original file is now lost, as it no +// longer exists. +// +// Instead, watch the parent directory and use Event.Name to filter out files +// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. +func (w *Watcher) Add(name string) error { + name = filepath.Clean(name) + if w.isClosed() { + return errors.New("inotify instance already closed") + } + + var flags uint32 = unix.IN_MOVED_TO | unix.IN_MOVED_FROM | + unix.IN_CREATE | unix.IN_ATTRIB | unix.IN_MODIFY | + unix.IN_MOVE_SELF | unix.IN_DELETE | unix.IN_DELETE_SELF + + w.mu.Lock() + defer w.mu.Unlock() + watchEntry := w.watches[name] + if watchEntry != nil { + flags |= watchEntry.flags | unix.IN_MASK_ADD + } + wd, errno := unix.InotifyAddWatch(w.fd, name, flags) + if wd == -1 { + return errno + } + + if watchEntry == nil { + w.watches[name] = &watch{wd: uint32(wd), flags: flags} + w.paths[wd] = name + } else { + watchEntry.wd = uint32(wd) + watchEntry.flags = flags + } + + return nil +} + +// Remove stops monitoring the path for changes. +// +// Directories are always removed non-recursively. For example, if you added +// /tmp/dir and /tmp/dir/subdir then you will need to remove both. +// +// Removing a path that has not yet been added returns [ErrNonExistentWatch]. +func (w *Watcher) Remove(name string) error { + name = filepath.Clean(name) + + // Fetch the watch. + w.mu.Lock() + defer w.mu.Unlock() + watch, ok := w.watches[name] + + // Remove it from inotify. + if !ok { + return fmt.Errorf("%w: %s", ErrNonExistentWatch, name) + } + + // We successfully removed the watch if InotifyRmWatch doesn't return an + // error, we need to clean up our internal state to ensure it matches + // inotify's kernel state. + delete(w.paths, int(watch.wd)) + delete(w.watches, name) + + // inotify_rm_watch will return EINVAL if the file has been deleted; + // the inotify will already have been removed. + // watches and pathes are deleted in ignoreLinux() implicitly and asynchronously + // by calling inotify_rm_watch() below. e.g. readEvents() goroutine receives IN_IGNORE + // so that EINVAL means that the wd is being rm_watch()ed or its file removed + // by another thread and we have not received IN_IGNORE event. + success, errno := unix.InotifyRmWatch(w.fd, watch.wd) + if success == -1 { + // TODO: Perhaps it's not helpful to return an error here in every case; + // The only two possible errors are: + // + // - EBADF, which happens when w.fd is not a valid file descriptor + // of any kind. + // - EINVAL, which is when fd is not an inotify descriptor or wd + // is not a valid watch descriptor. Watch descriptors are + // invalidated when they are removed explicitly or implicitly; + // explicitly by inotify_rm_watch, implicitly when the file they + // are watching is deleted. + return errno + } + + return nil +} + +// WatchList returns all paths added with [Add] (and are not yet removed). +func (w *Watcher) WatchList() []string { + w.mu.Lock() + defer w.mu.Unlock() + + entries := make([]string, 0, len(w.watches)) + for pathname := range w.watches { + entries = append(entries, pathname) + } + + return entries +} + +type watch struct { + wd uint32 // Watch descriptor (as returned by the inotify_add_watch() syscall) + flags uint32 // inotify flags of this watch (see inotify(7) for the list of valid flags) +} + +// readEvents reads from the inotify file descriptor, converts the +// received events into Event objects and sends them via the Events channel +func (w *Watcher) readEvents() { + defer func() { + close(w.doneResp) + close(w.Errors) + close(w.Events) + }() + + var ( + buf [unix.SizeofInotifyEvent * 4096]byte // Buffer for a maximum of 4096 raw events + errno error // Syscall errno + ) + for { + // See if we have been closed. + if w.isClosed() { + return + } + + n, err := w.inotifyFile.Read(buf[:]) + switch { + case errors.Unwrap(err) == os.ErrClosed: + return + case err != nil: + if !w.sendError(err) { + return + } + continue + } + + if n < unix.SizeofInotifyEvent { + var err error + if n == 0 { + // If EOF is received. This should really never happen. + err = io.EOF + } else if n < 0 { + // If an error occurred while reading. + err = errno + } else { + // Read was too short. + err = errors.New("notify: short read in readEvents()") + } + if !w.sendError(err) { + return + } + continue + } + + var offset uint32 + // We don't know how many events we just read into the buffer + // While the offset points to at least one whole event... + for offset <= uint32(n-unix.SizeofInotifyEvent) { + var ( + // Point "raw" to the event in the buffer + raw = (*unix.InotifyEvent)(unsafe.Pointer(&buf[offset])) + mask = uint32(raw.Mask) + nameLen = uint32(raw.Len) + ) + + if mask&unix.IN_Q_OVERFLOW != 0 { + if !w.sendError(ErrEventOverflow) { + return + } + } + + // If the event happened to the watched directory or the watched file, the kernel + // doesn't append the filename to the event, but we would like to always fill the + // the "Name" field with a valid filename. We retrieve the path of the watch from + // the "paths" map. + w.mu.Lock() + name, ok := w.paths[int(raw.Wd)] + // IN_DELETE_SELF occurs when the file/directory being watched is removed. + // This is a sign to clean up the maps, otherwise we are no longer in sync + // with the inotify kernel state which has already deleted the watch + // automatically. + if ok && mask&unix.IN_DELETE_SELF == unix.IN_DELETE_SELF { + delete(w.paths, int(raw.Wd)) + delete(w.watches, name) + } + w.mu.Unlock() + + if nameLen > 0 { + // Point "bytes" at the first byte of the filename + bytes := (*[unix.PathMax]byte)(unsafe.Pointer(&buf[offset+unix.SizeofInotifyEvent]))[:nameLen:nameLen] + // The filename is padded with NULL bytes. TrimRight() gets rid of those. + name += "/" + strings.TrimRight(string(bytes[0:nameLen]), "\000") + } + + event := w.newEvent(name, mask) + + // Send the events that are not ignored on the events channel + if mask&unix.IN_IGNORED == 0 { + if !w.sendEvent(event) { + return + } + } + + // Move to the next event in the buffer + offset += unix.SizeofInotifyEvent + nameLen + } + } +} + +// newEvent returns an platform-independent Event based on an inotify mask. +func (w *Watcher) newEvent(name string, mask uint32) Event { + e := Event{Name: name} + if mask&unix.IN_CREATE == unix.IN_CREATE || mask&unix.IN_MOVED_TO == unix.IN_MOVED_TO { + e.Op |= Create + } + if mask&unix.IN_DELETE_SELF == unix.IN_DELETE_SELF || mask&unix.IN_DELETE == unix.IN_DELETE { + e.Op |= Remove + } + if mask&unix.IN_MODIFY == unix.IN_MODIFY { + e.Op |= Write + } + if mask&unix.IN_MOVE_SELF == unix.IN_MOVE_SELF || mask&unix.IN_MOVED_FROM == unix.IN_MOVED_FROM { + e.Op |= Rename + } + if mask&unix.IN_ATTRIB == unix.IN_ATTRIB { + e.Op |= Chmod + } + return e +} diff --git a/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go b/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go new file mode 100644 index 0000000..2908746 --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/backend_kqueue.go @@ -0,0 +1,707 @@ +//go:build freebsd || openbsd || netbsd || dragonfly || darwin +// +build freebsd openbsd netbsd dragonfly darwin + +package fsnotify + +import ( + "errors" + "fmt" + "io/ioutil" + "os" + "path/filepath" + "sync" + + "golang.org/x/sys/unix" +) + +// Watcher watches a set of paths, delivering events on a channel. +// +// A watcher should not be copied (e.g. pass it by pointer, rather than by +// value). +// +// # Linux notes +// +// When a file is removed a Remove event won't be emitted until all file +// descriptors are closed, and deletes will always emit a Chmod. For example: +// +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove +// +// This is the event that inotify sends, so not much can be changed about this. +// +// The fs.inotify.max_user_watches sysctl variable specifies the upper limit +// for the number of watches per user, and fs.inotify.max_user_instances +// specifies the maximum number of inotify instances per user. Every Watcher you +// create is an "instance", and every path you add is a "watch". +// +// These are also exposed in /proc as /proc/sys/fs/inotify/max_user_watches and +// /proc/sys/fs/inotify/max_user_instances +// +// To increase them you can use sysctl or write the value to the /proc file: +// +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 +// +// To make the changes persist on reboot edit /etc/sysctl.conf or +// /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check +// your distro's documentation): +// +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 +// +// Reaching the limit will result in a "no space left on device" or "too many open +// files" error. +// +// # kqueue notes (macOS, BSD) +// +// kqueue requires opening a file descriptor for every file that's being watched; +// so if you're watching a directory with five files then that's six file +// descriptors. You will run in to your system's "max open files" limit faster on +// these platforms. +// +// The sysctl variables kern.maxfiles and kern.maxfilesperproc can be used to +// control the maximum number of open files, as well as /etc/login.conf on BSD +// systems. +// +// # macOS notes +// +// Spotlight indexing on macOS can result in multiple events (see [#15]). A +// temporary workaround is to add your folder(s) to the "Spotlight Privacy +// Settings" until we have a native FSEvents implementation (see [#11]). +// +// [#11]: https://github.com/fsnotify/fsnotify/issues/11 +// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +type Watcher struct { + // Events sends the filesystem change events. + // + // fsnotify can send the following events; a "path" here can refer to a + // file, directory, symbolic link, or special file like a FIFO. + // + // fsnotify.Create A new path was created; this may be followed by one + // or more Write events if data also gets written to a + // file. + // + // fsnotify.Remove A path was removed. + // + // fsnotify.Rename A path was renamed. A rename is always sent with the + // old path as Event.Name, and a Create event will be + // sent with the new name. Renames are only sent for + // paths that are currently watched; e.g. moving an + // unmonitored file into a monitored directory will + // show up as just a Create. Similarly, renaming a file + // to outside a monitored directory will show up as + // only a Rename. + // + // fsnotify.Write A file or named pipe was written to. A Truncate will + // also trigger a Write. A single "write action" + // initiated by the user may show up as one or multiple + // writes, depending on when the system syncs things to + // disk. For example when compiling a large Go program + // you may get hundreds of Write events, so you + // probably want to wait until you've stopped receiving + // them (see the dedup example in cmd/fsnotify). + // + // fsnotify.Chmod Attributes were changed. On Linux this is also sent + // when a file is removed (or more accurately, when a + // link to an inode is removed). On kqueue it's sent + // and on kqueue when a file is truncated. On Windows + // it's never sent. + Events chan Event + + // Errors sends any errors. + Errors chan error + + done chan struct{} + kq int // File descriptor (as returned by the kqueue() syscall). + closepipe [2]int // Pipe used for closing. + mu sync.Mutex // Protects access to watcher data + watches map[string]int // Watched file descriptors (key: path). + watchesByDir map[string]map[int]struct{} // Watched file descriptors indexed by the parent directory (key: dirname(path)). + userWatches map[string]struct{} // Watches added with Watcher.Add() + dirFlags map[string]uint32 // Watched directories to fflags used in kqueue. + paths map[int]pathInfo // File descriptors to path names for processing kqueue events. + fileExists map[string]struct{} // Keep track of if we know this file exists (to stop duplicate create events). + isClosed bool // Set to true when Close() is first called +} + +type pathInfo struct { + name string + isDir bool +} + +// NewWatcher creates a new Watcher. +func NewWatcher() (*Watcher, error) { + kq, closepipe, err := newKqueue() + if err != nil { + return nil, err + } + + w := &Watcher{ + kq: kq, + closepipe: closepipe, + watches: make(map[string]int), + watchesByDir: make(map[string]map[int]struct{}), + dirFlags: make(map[string]uint32), + paths: make(map[int]pathInfo), + fileExists: make(map[string]struct{}), + userWatches: make(map[string]struct{}), + Events: make(chan Event), + Errors: make(chan error), + done: make(chan struct{}), + } + + go w.readEvents() + return w, nil +} + +// newKqueue creates a new kernel event queue and returns a descriptor. +// +// This registers a new event on closepipe, which will trigger an event when +// it's closed. This way we can use kevent() without timeout/polling; without +// the closepipe, it would block forever and we wouldn't be able to stop it at +// all. +func newKqueue() (kq int, closepipe [2]int, err error) { + kq, err = unix.Kqueue() + if kq == -1 { + return kq, closepipe, err + } + + // Register the close pipe. + err = unix.Pipe(closepipe[:]) + if err != nil { + unix.Close(kq) + return kq, closepipe, err + } + + // Register changes to listen on the closepipe. + changes := make([]unix.Kevent_t, 1) + // SetKevent converts int to the platform-specific types. + unix.SetKevent(&changes[0], closepipe[0], unix.EVFILT_READ, + unix.EV_ADD|unix.EV_ENABLE|unix.EV_ONESHOT) + + ok, err := unix.Kevent(kq, changes, nil, nil) + if ok == -1 { + unix.Close(kq) + unix.Close(closepipe[0]) + unix.Close(closepipe[1]) + return kq, closepipe, err + } + return kq, closepipe, nil +} + +// Returns true if the event was sent, or false if watcher is closed. +func (w *Watcher) sendEvent(e Event) bool { + select { + case w.Events <- e: + return true + case <-w.done: + } + return false +} + +// Returns true if the error was sent, or false if watcher is closed. +func (w *Watcher) sendError(err error) bool { + select { + case w.Errors <- err: + return true + case <-w.done: + } + return false +} + +// Close removes all watches and closes the events channel. +func (w *Watcher) Close() error { + w.mu.Lock() + if w.isClosed { + w.mu.Unlock() + return nil + } + w.isClosed = true + + // copy paths to remove while locked + pathsToRemove := make([]string, 0, len(w.watches)) + for name := range w.watches { + pathsToRemove = append(pathsToRemove, name) + } + w.mu.Unlock() // Unlock before calling Remove, which also locks + for _, name := range pathsToRemove { + w.Remove(name) + } + + // Send "quit" message to the reader goroutine. + unix.Close(w.closepipe[1]) + close(w.done) + + return nil +} + +// Add starts monitoring the path for changes. +// +// A path can only be watched once; attempting to watch it more than once will +// return an error. Paths that do not yet exist on the filesystem cannot be +// added. A watch will be automatically removed if the path is deleted. +// +// A path will remain watched if it gets renamed to somewhere else on the same +// filesystem, but the monitor will get removed if the path gets deleted and +// re-created, or if it's moved to a different filesystem. +// +// Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special +// filesystems (/proc, /sys, etc.) generally don't work. +// +// # Watching directories +// +// All files in a directory are monitored, including new files that are created +// after the watcher is started. Subdirectories are not watched (i.e. it's +// non-recursive). +// +// # Watching files +// +// Watching individual files (rather than directories) is generally not +// recommended as many tools update files atomically. Instead of "just" writing +// to the file a temporary file will be written to first, and if successful the +// temporary file is moved to to destination removing the original, or some +// variant thereof. The watcher on the original file is now lost, as it no +// longer exists. +// +// Instead, watch the parent directory and use Event.Name to filter out files +// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. +func (w *Watcher) Add(name string) error { + w.mu.Lock() + w.userWatches[name] = struct{}{} + w.mu.Unlock() + _, err := w.addWatch(name, noteAllEvents) + return err +} + +// Remove stops monitoring the path for changes. +// +// Directories are always removed non-recursively. For example, if you added +// /tmp/dir and /tmp/dir/subdir then you will need to remove both. +// +// Removing a path that has not yet been added returns [ErrNonExistentWatch]. +func (w *Watcher) Remove(name string) error { + name = filepath.Clean(name) + w.mu.Lock() + watchfd, ok := w.watches[name] + w.mu.Unlock() + if !ok { + return fmt.Errorf("%w: %s", ErrNonExistentWatch, name) + } + + err := w.register([]int{watchfd}, unix.EV_DELETE, 0) + if err != nil { + return err + } + + unix.Close(watchfd) + + w.mu.Lock() + isDir := w.paths[watchfd].isDir + delete(w.watches, name) + delete(w.userWatches, name) + + parentName := filepath.Dir(name) + delete(w.watchesByDir[parentName], watchfd) + + if len(w.watchesByDir[parentName]) == 0 { + delete(w.watchesByDir, parentName) + } + + delete(w.paths, watchfd) + delete(w.dirFlags, name) + delete(w.fileExists, name) + w.mu.Unlock() + + // Find all watched paths that are in this directory that are not external. + if isDir { + var pathsToRemove []string + w.mu.Lock() + for fd := range w.watchesByDir[name] { + path := w.paths[fd] + if _, ok := w.userWatches[path.name]; !ok { + pathsToRemove = append(pathsToRemove, path.name) + } + } + w.mu.Unlock() + for _, name := range pathsToRemove { + // Since these are internal, not much sense in propagating error + // to the user, as that will just confuse them with an error about + // a path they did not explicitly watch themselves. + w.Remove(name) + } + } + + return nil +} + +// WatchList returns all paths added with [Add] (and are not yet removed). +func (w *Watcher) WatchList() []string { + w.mu.Lock() + defer w.mu.Unlock() + + entries := make([]string, 0, len(w.userWatches)) + for pathname := range w.userWatches { + entries = append(entries, pathname) + } + + return entries +} + +// Watch all events (except NOTE_EXTEND, NOTE_LINK, NOTE_REVOKE) +const noteAllEvents = unix.NOTE_DELETE | unix.NOTE_WRITE | unix.NOTE_ATTRIB | unix.NOTE_RENAME + +// addWatch adds name to the watched file set. +// The flags are interpreted as described in kevent(2). +// Returns the real path to the file which was added, if any, which may be different from the one passed in the case of symlinks. +func (w *Watcher) addWatch(name string, flags uint32) (string, error) { + var isDir bool + // Make ./name and name equivalent + name = filepath.Clean(name) + + w.mu.Lock() + if w.isClosed { + w.mu.Unlock() + return "", errors.New("kevent instance already closed") + } + watchfd, alreadyWatching := w.watches[name] + // We already have a watch, but we can still override flags. + if alreadyWatching { + isDir = w.paths[watchfd].isDir + } + w.mu.Unlock() + + if !alreadyWatching { + fi, err := os.Lstat(name) + if err != nil { + return "", err + } + + // Don't watch sockets or named pipes + if (fi.Mode()&os.ModeSocket == os.ModeSocket) || (fi.Mode()&os.ModeNamedPipe == os.ModeNamedPipe) { + return "", nil + } + + // Follow Symlinks + // + // Linux can add unresolvable symlinks to the watch list without issue, + // and Windows can't do symlinks period. To maintain consistency, we + // will act like everything is fine if the link can't be resolved. + // There will simply be no file events for broken symlinks. Hence the + // returns of nil on errors. + if fi.Mode()&os.ModeSymlink == os.ModeSymlink { + name, err = filepath.EvalSymlinks(name) + if err != nil { + return "", nil + } + + w.mu.Lock() + _, alreadyWatching = w.watches[name] + w.mu.Unlock() + + if alreadyWatching { + return name, nil + } + + fi, err = os.Lstat(name) + if err != nil { + return "", nil + } + } + + // Retry on EINTR; open() can return EINTR in practice on macOS. + // See #354, and go issues 11180 and 39237. + for { + watchfd, err = unix.Open(name, openMode, 0) + if err == nil { + break + } + if errors.Is(err, unix.EINTR) { + continue + } + + return "", err + } + + isDir = fi.IsDir() + } + + err := w.register([]int{watchfd}, unix.EV_ADD|unix.EV_CLEAR|unix.EV_ENABLE, flags) + if err != nil { + unix.Close(watchfd) + return "", err + } + + if !alreadyWatching { + w.mu.Lock() + parentName := filepath.Dir(name) + w.watches[name] = watchfd + + watchesByDir, ok := w.watchesByDir[parentName] + if !ok { + watchesByDir = make(map[int]struct{}, 1) + w.watchesByDir[parentName] = watchesByDir + } + watchesByDir[watchfd] = struct{}{} + + w.paths[watchfd] = pathInfo{name: name, isDir: isDir} + w.mu.Unlock() + } + + if isDir { + // Watch the directory if it has not been watched before, + // or if it was watched before, but perhaps only a NOTE_DELETE (watchDirectoryFiles) + w.mu.Lock() + + watchDir := (flags&unix.NOTE_WRITE) == unix.NOTE_WRITE && + (!alreadyWatching || (w.dirFlags[name]&unix.NOTE_WRITE) != unix.NOTE_WRITE) + // Store flags so this watch can be updated later + w.dirFlags[name] = flags + w.mu.Unlock() + + if watchDir { + if err := w.watchDirectoryFiles(name); err != nil { + return "", err + } + } + } + return name, nil +} + +// readEvents reads from kqueue and converts the received kevents into +// Event values that it sends down the Events channel. +func (w *Watcher) readEvents() { + defer func() { + err := unix.Close(w.kq) + if err != nil { + w.Errors <- err + } + unix.Close(w.closepipe[0]) + close(w.Events) + close(w.Errors) + }() + + eventBuffer := make([]unix.Kevent_t, 10) + for closed := false; !closed; { + kevents, err := w.read(eventBuffer) + // EINTR is okay, the syscall was interrupted before timeout expired. + if err != nil && err != unix.EINTR { + if !w.sendError(fmt.Errorf("fsnotify.readEvents: %w", err)) { + closed = true + } + continue + } + + // Flush the events we received to the Events channel + for _, kevent := range kevents { + var ( + watchfd = int(kevent.Ident) + mask = uint32(kevent.Fflags) + ) + + // Shut down the loop when the pipe is closed, but only after all + // other events have been processed. + if watchfd == w.closepipe[0] { + closed = true + continue + } + + w.mu.Lock() + path := w.paths[watchfd] + w.mu.Unlock() + + event := w.newEvent(path.name, mask) + + if path.isDir && !event.Has(Remove) { + // Double check to make sure the directory exists. This can + // happen when we do a rm -fr on a recursively watched folders + // and we receive a modification event first but the folder has + // been deleted and later receive the delete event. + if _, err := os.Lstat(event.Name); os.IsNotExist(err) { + event.Op |= Remove + } + } + + if event.Has(Rename) || event.Has(Remove) { + w.Remove(event.Name) + w.mu.Lock() + delete(w.fileExists, event.Name) + w.mu.Unlock() + } + + if path.isDir && event.Has(Write) && !event.Has(Remove) { + w.sendDirectoryChangeEvents(event.Name) + } else { + if !w.sendEvent(event) { + closed = true + continue + } + } + + if event.Has(Remove) { + // Look for a file that may have overwritten this. + // For example, mv f1 f2 will delete f2, then create f2. + if path.isDir { + fileDir := filepath.Clean(event.Name) + w.mu.Lock() + _, found := w.watches[fileDir] + w.mu.Unlock() + if found { + // make sure the directory exists before we watch for changes. When we + // do a recursive watch and perform rm -fr, the parent directory might + // have gone missing, ignore the missing directory and let the + // upcoming delete event remove the watch from the parent directory. + if _, err := os.Lstat(fileDir); err == nil { + w.sendDirectoryChangeEvents(fileDir) + } + } + } else { + filePath := filepath.Clean(event.Name) + if fileInfo, err := os.Lstat(filePath); err == nil { + w.sendFileCreatedEventIfNew(filePath, fileInfo) + } + } + } + } + } +} + +// newEvent returns an platform-independent Event based on kqueue Fflags. +func (w *Watcher) newEvent(name string, mask uint32) Event { + e := Event{Name: name} + if mask&unix.NOTE_DELETE == unix.NOTE_DELETE { + e.Op |= Remove + } + if mask&unix.NOTE_WRITE == unix.NOTE_WRITE { + e.Op |= Write + } + if mask&unix.NOTE_RENAME == unix.NOTE_RENAME { + e.Op |= Rename + } + if mask&unix.NOTE_ATTRIB == unix.NOTE_ATTRIB { + e.Op |= Chmod + } + return e +} + +// watchDirectoryFiles to mimic inotify when adding a watch on a directory +func (w *Watcher) watchDirectoryFiles(dirPath string) error { + // Get all files + files, err := ioutil.ReadDir(dirPath) + if err != nil { + return err + } + + for _, fileInfo := range files { + path := filepath.Join(dirPath, fileInfo.Name()) + + cleanPath, err := w.internalWatch(path, fileInfo) + if err != nil { + // No permission to read the file; that's not a problem: just skip. + // But do add it to w.fileExists to prevent it from being picked up + // as a "new" file later (it still shows up in the directory + // listing). + switch { + case errors.Is(err, unix.EACCES) || errors.Is(err, unix.EPERM): + cleanPath = filepath.Clean(path) + default: + return fmt.Errorf("%q: %w", filepath.Join(dirPath, fileInfo.Name()), err) + } + } + + w.mu.Lock() + w.fileExists[cleanPath] = struct{}{} + w.mu.Unlock() + } + + return nil +} + +// Search the directory for new files and send an event for them. +// +// This functionality is to have the BSD watcher match the inotify, which sends +// a create event for files created in a watched directory. +func (w *Watcher) sendDirectoryChangeEvents(dir string) { + // Get all files + files, err := ioutil.ReadDir(dir) + if err != nil { + if !w.sendError(fmt.Errorf("fsnotify.sendDirectoryChangeEvents: %w", err)) { + return + } + } + + // Search for new files + for _, fi := range files { + err := w.sendFileCreatedEventIfNew(filepath.Join(dir, fi.Name()), fi) + if err != nil { + return + } + } +} + +// sendFileCreatedEvent sends a create event if the file isn't already being tracked. +func (w *Watcher) sendFileCreatedEventIfNew(filePath string, fileInfo os.FileInfo) (err error) { + w.mu.Lock() + _, doesExist := w.fileExists[filePath] + w.mu.Unlock() + if !doesExist { + if !w.sendEvent(Event{Name: filePath, Op: Create}) { + return + } + } + + // like watchDirectoryFiles (but without doing another ReadDir) + filePath, err = w.internalWatch(filePath, fileInfo) + if err != nil { + return err + } + + w.mu.Lock() + w.fileExists[filePath] = struct{}{} + w.mu.Unlock() + + return nil +} + +func (w *Watcher) internalWatch(name string, fileInfo os.FileInfo) (string, error) { + if fileInfo.IsDir() { + // mimic Linux providing delete events for subdirectories + // but preserve the flags used if currently watching subdirectory + w.mu.Lock() + flags := w.dirFlags[name] + w.mu.Unlock() + + flags |= unix.NOTE_DELETE | unix.NOTE_RENAME + return w.addWatch(name, flags) + } + + // watch file to mimic Linux inotify + return w.addWatch(name, noteAllEvents) +} + +// Register events with the queue. +func (w *Watcher) register(fds []int, flags int, fflags uint32) error { + changes := make([]unix.Kevent_t, len(fds)) + for i, fd := range fds { + // SetKevent converts int to the platform-specific types. + unix.SetKevent(&changes[i], fd, unix.EVFILT_VNODE, flags) + changes[i].Fflags = fflags + } + + // Register the events. + success, err := unix.Kevent(w.kq, changes, nil, nil) + if success == -1 { + return err + } + return nil +} + +// read retrieves pending events, or waits until an event occurs. +func (w *Watcher) read(events []unix.Kevent_t) ([]unix.Kevent_t, error) { + n, err := unix.Kevent(w.kq, nil, events, nil) + if err != nil { + return nil, err + } + return events[0:n], nil +} diff --git a/vendor/github.com/fsnotify/fsnotify/backend_other.go b/vendor/github.com/fsnotify/fsnotify/backend_other.go new file mode 100644 index 0000000..a9bb1c3 --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/backend_other.go @@ -0,0 +1,66 @@ +//go:build !darwin && !dragonfly && !freebsd && !openbsd && !linux && !netbsd && !solaris && !windows +// +build !darwin,!dragonfly,!freebsd,!openbsd,!linux,!netbsd,!solaris,!windows + +package fsnotify + +import ( + "fmt" + "runtime" +) + +// Watcher watches a set of files, delivering events to a channel. +type Watcher struct{} + +// NewWatcher creates a new Watcher. +func NewWatcher() (*Watcher, error) { + return nil, fmt.Errorf("fsnotify not supported on %s", runtime.GOOS) +} + +// Close removes all watches and closes the events channel. +func (w *Watcher) Close() error { + return nil +} + +// Add starts monitoring the path for changes. +// +// A path can only be watched once; attempting to watch it more than once will +// return an error. Paths that do not yet exist on the filesystem cannot be +// added. A watch will be automatically removed if the path is deleted. +// +// A path will remain watched if it gets renamed to somewhere else on the same +// filesystem, but the monitor will get removed if the path gets deleted and +// re-created, or if it's moved to a different filesystem. +// +// Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special +// filesystems (/proc, /sys, etc.) generally don't work. +// +// # Watching directories +// +// All files in a directory are monitored, including new files that are created +// after the watcher is started. Subdirectories are not watched (i.e. it's +// non-recursive). +// +// # Watching files +// +// Watching individual files (rather than directories) is generally not +// recommended as many tools update files atomically. Instead of "just" writing +// to the file a temporary file will be written to first, and if successful the +// temporary file is moved to to destination removing the original, or some +// variant thereof. The watcher on the original file is now lost, as it no +// longer exists. +// +// Instead, watch the parent directory and use Event.Name to filter out files +// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. +func (w *Watcher) Add(name string) error { + return nil +} + +// Remove stops monitoring the path for changes. +// +// Directories are always removed non-recursively. For example, if you added +// /tmp/dir and /tmp/dir/subdir then you will need to remove both. +// +// Removing a path that has not yet been added returns [ErrNonExistentWatch]. +func (w *Watcher) Remove(name string) error { + return nil +} diff --git a/vendor/github.com/fsnotify/fsnotify/backend_windows.go b/vendor/github.com/fsnotify/fsnotify/backend_windows.go new file mode 100644 index 0000000..ae39286 --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/backend_windows.go @@ -0,0 +1,746 @@ +//go:build windows +// +build windows + +package fsnotify + +import ( + "errors" + "fmt" + "os" + "path/filepath" + "reflect" + "runtime" + "strings" + "sync" + "unsafe" + + "golang.org/x/sys/windows" +) + +// Watcher watches a set of paths, delivering events on a channel. +// +// A watcher should not be copied (e.g. pass it by pointer, rather than by +// value). +// +// # Linux notes +// +// When a file is removed a Remove event won't be emitted until all file +// descriptors are closed, and deletes will always emit a Chmod. For example: +// +// fp := os.Open("file") +// os.Remove("file") // Triggers Chmod +// fp.Close() // Triggers Remove +// +// This is the event that inotify sends, so not much can be changed about this. +// +// The fs.inotify.max_user_watches sysctl variable specifies the upper limit +// for the number of watches per user, and fs.inotify.max_user_instances +// specifies the maximum number of inotify instances per user. Every Watcher you +// create is an "instance", and every path you add is a "watch". +// +// These are also exposed in /proc as /proc/sys/fs/inotify/max_user_watches and +// /proc/sys/fs/inotify/max_user_instances +// +// To increase them you can use sysctl or write the value to the /proc file: +// +// # Default values on Linux 5.18 +// sysctl fs.inotify.max_user_watches=124983 +// sysctl fs.inotify.max_user_instances=128 +// +// To make the changes persist on reboot edit /etc/sysctl.conf or +// /usr/lib/sysctl.d/50-default.conf (details differ per Linux distro; check +// your distro's documentation): +// +// fs.inotify.max_user_watches=124983 +// fs.inotify.max_user_instances=128 +// +// Reaching the limit will result in a "no space left on device" or "too many open +// files" error. +// +// # kqueue notes (macOS, BSD) +// +// kqueue requires opening a file descriptor for every file that's being watched; +// so if you're watching a directory with five files then that's six file +// descriptors. You will run in to your system's "max open files" limit faster on +// these platforms. +// +// The sysctl variables kern.maxfiles and kern.maxfilesperproc can be used to +// control the maximum number of open files, as well as /etc/login.conf on BSD +// systems. +// +// # macOS notes +// +// Spotlight indexing on macOS can result in multiple events (see [#15]). A +// temporary workaround is to add your folder(s) to the "Spotlight Privacy +// Settings" until we have a native FSEvents implementation (see [#11]). +// +// [#11]: https://github.com/fsnotify/fsnotify/issues/11 +// [#15]: https://github.com/fsnotify/fsnotify/issues/15 +type Watcher struct { + // Events sends the filesystem change events. + // + // fsnotify can send the following events; a "path" here can refer to a + // file, directory, symbolic link, or special file like a FIFO. + // + // fsnotify.Create A new path was created; this may be followed by one + // or more Write events if data also gets written to a + // file. + // + // fsnotify.Remove A path was removed. + // + // fsnotify.Rename A path was renamed. A rename is always sent with the + // old path as Event.Name, and a Create event will be + // sent with the new name. Renames are only sent for + // paths that are currently watched; e.g. moving an + // unmonitored file into a monitored directory will + // show up as just a Create. Similarly, renaming a file + // to outside a monitored directory will show up as + // only a Rename. + // + // fsnotify.Write A file or named pipe was written to. A Truncate will + // also trigger a Write. A single "write action" + // initiated by the user may show up as one or multiple + // writes, depending on when the system syncs things to + // disk. For example when compiling a large Go program + // you may get hundreds of Write events, so you + // probably want to wait until you've stopped receiving + // them (see the dedup example in cmd/fsnotify). + // + // fsnotify.Chmod Attributes were changed. On Linux this is also sent + // when a file is removed (or more accurately, when a + // link to an inode is removed). On kqueue it's sent + // and on kqueue when a file is truncated. On Windows + // it's never sent. + Events chan Event + + // Errors sends any errors. + Errors chan error + + port windows.Handle // Handle to completion port + input chan *input // Inputs to the reader are sent on this channel + quit chan chan<- error + + mu sync.Mutex // Protects access to watches, isClosed + watches watchMap // Map of watches (key: i-number) + isClosed bool // Set to true when Close() is first called +} + +// NewWatcher creates a new Watcher. +func NewWatcher() (*Watcher, error) { + port, err := windows.CreateIoCompletionPort(windows.InvalidHandle, 0, 0, 0) + if err != nil { + return nil, os.NewSyscallError("CreateIoCompletionPort", err) + } + w := &Watcher{ + port: port, + watches: make(watchMap), + input: make(chan *input, 1), + Events: make(chan Event, 50), + Errors: make(chan error), + quit: make(chan chan<- error, 1), + } + go w.readEvents() + return w, nil +} + +func (w *Watcher) sendEvent(name string, mask uint64) bool { + if mask == 0 { + return false + } + + event := w.newEvent(name, uint32(mask)) + select { + case ch := <-w.quit: + w.quit <- ch + case w.Events <- event: + } + return true +} + +// Returns true if the error was sent, or false if watcher is closed. +func (w *Watcher) sendError(err error) bool { + select { + case w.Errors <- err: + return true + case <-w.quit: + } + return false +} + +// Close removes all watches and closes the events channel. +func (w *Watcher) Close() error { + w.mu.Lock() + if w.isClosed { + w.mu.Unlock() + return nil + } + w.isClosed = true + w.mu.Unlock() + + // Send "quit" message to the reader goroutine + ch := make(chan error) + w.quit <- ch + if err := w.wakeupReader(); err != nil { + return err + } + return <-ch +} + +// Add starts monitoring the path for changes. +// +// A path can only be watched once; attempting to watch it more than once will +// return an error. Paths that do not yet exist on the filesystem cannot be +// added. A watch will be automatically removed if the path is deleted. +// +// A path will remain watched if it gets renamed to somewhere else on the same +// filesystem, but the monitor will get removed if the path gets deleted and +// re-created, or if it's moved to a different filesystem. +// +// Notifications on network filesystems (NFS, SMB, FUSE, etc.) or special +// filesystems (/proc, /sys, etc.) generally don't work. +// +// # Watching directories +// +// All files in a directory are monitored, including new files that are created +// after the watcher is started. Subdirectories are not watched (i.e. it's +// non-recursive). +// +// # Watching files +// +// Watching individual files (rather than directories) is generally not +// recommended as many tools update files atomically. Instead of "just" writing +// to the file a temporary file will be written to first, and if successful the +// temporary file is moved to to destination removing the original, or some +// variant thereof. The watcher on the original file is now lost, as it no +// longer exists. +// +// Instead, watch the parent directory and use Event.Name to filter out files +// you're not interested in. There is an example of this in [cmd/fsnotify/file.go]. +func (w *Watcher) Add(name string) error { + w.mu.Lock() + if w.isClosed { + w.mu.Unlock() + return errors.New("watcher already closed") + } + w.mu.Unlock() + + in := &input{ + op: opAddWatch, + path: filepath.Clean(name), + flags: sysFSALLEVENTS, + reply: make(chan error), + } + w.input <- in + if err := w.wakeupReader(); err != nil { + return err + } + return <-in.reply +} + +// Remove stops monitoring the path for changes. +// +// Directories are always removed non-recursively. For example, if you added +// /tmp/dir and /tmp/dir/subdir then you will need to remove both. +// +// Removing a path that has not yet been added returns [ErrNonExistentWatch]. +func (w *Watcher) Remove(name string) error { + in := &input{ + op: opRemoveWatch, + path: filepath.Clean(name), + reply: make(chan error), + } + w.input <- in + if err := w.wakeupReader(); err != nil { + return err + } + return <-in.reply +} + +// WatchList returns all paths added with [Add] (and are not yet removed). +func (w *Watcher) WatchList() []string { + w.mu.Lock() + defer w.mu.Unlock() + + entries := make([]string, 0, len(w.watches)) + for _, entry := range w.watches { + for _, watchEntry := range entry { + entries = append(entries, watchEntry.path) + } + } + + return entries +} + +// These options are from the old golang.org/x/exp/winfsnotify, where you could +// add various options to the watch. This has long since been removed. +// +// The "sys" in the name is misleading as they're not part of any "system". +// +// This should all be removed at some point, and just use windows.FILE_NOTIFY_* +const ( + sysFSALLEVENTS = 0xfff + sysFSATTRIB = 0x4 + sysFSCREATE = 0x100 + sysFSDELETE = 0x200 + sysFSDELETESELF = 0x400 + sysFSMODIFY = 0x2 + sysFSMOVE = 0xc0 + sysFSMOVEDFROM = 0x40 + sysFSMOVEDTO = 0x80 + sysFSMOVESELF = 0x800 + sysFSIGNORED = 0x8000 +) + +func (w *Watcher) newEvent(name string, mask uint32) Event { + e := Event{Name: name} + if mask&sysFSCREATE == sysFSCREATE || mask&sysFSMOVEDTO == sysFSMOVEDTO { + e.Op |= Create + } + if mask&sysFSDELETE == sysFSDELETE || mask&sysFSDELETESELF == sysFSDELETESELF { + e.Op |= Remove + } + if mask&sysFSMODIFY == sysFSMODIFY { + e.Op |= Write + } + if mask&sysFSMOVE == sysFSMOVE || mask&sysFSMOVESELF == sysFSMOVESELF || mask&sysFSMOVEDFROM == sysFSMOVEDFROM { + e.Op |= Rename + } + if mask&sysFSATTRIB == sysFSATTRIB { + e.Op |= Chmod + } + return e +} + +const ( + opAddWatch = iota + opRemoveWatch +) + +const ( + provisional uint64 = 1 << (32 + iota) +) + +type input struct { + op int + path string + flags uint32 + reply chan error +} + +type inode struct { + handle windows.Handle + volume uint32 + index uint64 +} + +type watch struct { + ov windows.Overlapped + ino *inode // i-number + path string // Directory path + mask uint64 // Directory itself is being watched with these notify flags + names map[string]uint64 // Map of names being watched and their notify flags + rename string // Remembers the old name while renaming a file + buf [65536]byte // 64K buffer +} + +type ( + indexMap map[uint64]*watch + watchMap map[uint32]indexMap +) + +func (w *Watcher) wakeupReader() error { + err := windows.PostQueuedCompletionStatus(w.port, 0, 0, nil) + if err != nil { + return os.NewSyscallError("PostQueuedCompletionStatus", err) + } + return nil +} + +func (w *Watcher) getDir(pathname string) (dir string, err error) { + attr, err := windows.GetFileAttributes(windows.StringToUTF16Ptr(pathname)) + if err != nil { + return "", os.NewSyscallError("GetFileAttributes", err) + } + if attr&windows.FILE_ATTRIBUTE_DIRECTORY != 0 { + dir = pathname + } else { + dir, _ = filepath.Split(pathname) + dir = filepath.Clean(dir) + } + return +} + +func (w *Watcher) getIno(path string) (ino *inode, err error) { + h, err := windows.CreateFile(windows.StringToUTF16Ptr(path), + windows.FILE_LIST_DIRECTORY, + windows.FILE_SHARE_READ|windows.FILE_SHARE_WRITE|windows.FILE_SHARE_DELETE, + nil, windows.OPEN_EXISTING, + windows.FILE_FLAG_BACKUP_SEMANTICS|windows.FILE_FLAG_OVERLAPPED, 0) + if err != nil { + return nil, os.NewSyscallError("CreateFile", err) + } + + var fi windows.ByHandleFileInformation + err = windows.GetFileInformationByHandle(h, &fi) + if err != nil { + windows.CloseHandle(h) + return nil, os.NewSyscallError("GetFileInformationByHandle", err) + } + ino = &inode{ + handle: h, + volume: fi.VolumeSerialNumber, + index: uint64(fi.FileIndexHigh)<<32 | uint64(fi.FileIndexLow), + } + return ino, nil +} + +// Must run within the I/O thread. +func (m watchMap) get(ino *inode) *watch { + if i := m[ino.volume]; i != nil { + return i[ino.index] + } + return nil +} + +// Must run within the I/O thread. +func (m watchMap) set(ino *inode, watch *watch) { + i := m[ino.volume] + if i == nil { + i = make(indexMap) + m[ino.volume] = i + } + i[ino.index] = watch +} + +// Must run within the I/O thread. +func (w *Watcher) addWatch(pathname string, flags uint64) error { + dir, err := w.getDir(pathname) + if err != nil { + return err + } + + ino, err := w.getIno(dir) + if err != nil { + return err + } + w.mu.Lock() + watchEntry := w.watches.get(ino) + w.mu.Unlock() + if watchEntry == nil { + _, err := windows.CreateIoCompletionPort(ino.handle, w.port, 0, 0) + if err != nil { + windows.CloseHandle(ino.handle) + return os.NewSyscallError("CreateIoCompletionPort", err) + } + watchEntry = &watch{ + ino: ino, + path: dir, + names: make(map[string]uint64), + } + w.mu.Lock() + w.watches.set(ino, watchEntry) + w.mu.Unlock() + flags |= provisional + } else { + windows.CloseHandle(ino.handle) + } + if pathname == dir { + watchEntry.mask |= flags + } else { + watchEntry.names[filepath.Base(pathname)] |= flags + } + + err = w.startRead(watchEntry) + if err != nil { + return err + } + + if pathname == dir { + watchEntry.mask &= ^provisional + } else { + watchEntry.names[filepath.Base(pathname)] &= ^provisional + } + return nil +} + +// Must run within the I/O thread. +func (w *Watcher) remWatch(pathname string) error { + dir, err := w.getDir(pathname) + if err != nil { + return err + } + ino, err := w.getIno(dir) + if err != nil { + return err + } + + w.mu.Lock() + watch := w.watches.get(ino) + w.mu.Unlock() + + err = windows.CloseHandle(ino.handle) + if err != nil { + w.sendError(os.NewSyscallError("CloseHandle", err)) + } + if watch == nil { + return fmt.Errorf("%w: %s", ErrNonExistentWatch, pathname) + } + if pathname == dir { + w.sendEvent(watch.path, watch.mask&sysFSIGNORED) + watch.mask = 0 + } else { + name := filepath.Base(pathname) + w.sendEvent(filepath.Join(watch.path, name), watch.names[name]&sysFSIGNORED) + delete(watch.names, name) + } + + return w.startRead(watch) +} + +// Must run within the I/O thread. +func (w *Watcher) deleteWatch(watch *watch) { + for name, mask := range watch.names { + if mask&provisional == 0 { + w.sendEvent(filepath.Join(watch.path, name), mask&sysFSIGNORED) + } + delete(watch.names, name) + } + if watch.mask != 0 { + if watch.mask&provisional == 0 { + w.sendEvent(watch.path, watch.mask&sysFSIGNORED) + } + watch.mask = 0 + } +} + +// Must run within the I/O thread. +func (w *Watcher) startRead(watch *watch) error { + err := windows.CancelIo(watch.ino.handle) + if err != nil { + w.sendError(os.NewSyscallError("CancelIo", err)) + w.deleteWatch(watch) + } + mask := w.toWindowsFlags(watch.mask) + for _, m := range watch.names { + mask |= w.toWindowsFlags(m) + } + if mask == 0 { + err := windows.CloseHandle(watch.ino.handle) + if err != nil { + w.sendError(os.NewSyscallError("CloseHandle", err)) + } + w.mu.Lock() + delete(w.watches[watch.ino.volume], watch.ino.index) + w.mu.Unlock() + return nil + } + + rdErr := windows.ReadDirectoryChanges(watch.ino.handle, &watch.buf[0], + uint32(unsafe.Sizeof(watch.buf)), false, mask, nil, &watch.ov, 0) + if rdErr != nil { + err := os.NewSyscallError("ReadDirectoryChanges", rdErr) + if rdErr == windows.ERROR_ACCESS_DENIED && watch.mask&provisional == 0 { + // Watched directory was probably removed + w.sendEvent(watch.path, watch.mask&sysFSDELETESELF) + err = nil + } + w.deleteWatch(watch) + w.startRead(watch) + return err + } + return nil +} + +// readEvents reads from the I/O completion port, converts the +// received events into Event objects and sends them via the Events channel. +// Entry point to the I/O thread. +func (w *Watcher) readEvents() { + var ( + n uint32 + key uintptr + ov *windows.Overlapped + ) + runtime.LockOSThread() + + for { + qErr := windows.GetQueuedCompletionStatus(w.port, &n, &key, &ov, windows.INFINITE) + // This error is handled after the watch == nil check below. NOTE: this + // seems odd, note sure if it's correct. + + watch := (*watch)(unsafe.Pointer(ov)) + if watch == nil { + select { + case ch := <-w.quit: + w.mu.Lock() + var indexes []indexMap + for _, index := range w.watches { + indexes = append(indexes, index) + } + w.mu.Unlock() + for _, index := range indexes { + for _, watch := range index { + w.deleteWatch(watch) + w.startRead(watch) + } + } + + err := windows.CloseHandle(w.port) + if err != nil { + err = os.NewSyscallError("CloseHandle", err) + } + close(w.Events) + close(w.Errors) + ch <- err + return + case in := <-w.input: + switch in.op { + case opAddWatch: + in.reply <- w.addWatch(in.path, uint64(in.flags)) + case opRemoveWatch: + in.reply <- w.remWatch(in.path) + } + default: + } + continue + } + + switch qErr { + case windows.ERROR_MORE_DATA: + if watch == nil { + w.sendError(errors.New("ERROR_MORE_DATA has unexpectedly null lpOverlapped buffer")) + } else { + // The i/o succeeded but the buffer is full. + // In theory we should be building up a full packet. + // In practice we can get away with just carrying on. + n = uint32(unsafe.Sizeof(watch.buf)) + } + case windows.ERROR_ACCESS_DENIED: + // Watched directory was probably removed + w.sendEvent(watch.path, watch.mask&sysFSDELETESELF) + w.deleteWatch(watch) + w.startRead(watch) + continue + case windows.ERROR_OPERATION_ABORTED: + // CancelIo was called on this handle + continue + default: + w.sendError(os.NewSyscallError("GetQueuedCompletionPort", qErr)) + continue + case nil: + } + + var offset uint32 + for { + if n == 0 { + w.sendError(errors.New("short read in readEvents()")) + break + } + + // Point "raw" to the event in the buffer + raw := (*windows.FileNotifyInformation)(unsafe.Pointer(&watch.buf[offset])) + + // Create a buf that is the size of the path name + size := int(raw.FileNameLength / 2) + var buf []uint16 + // TODO: Use unsafe.Slice in Go 1.17; https://stackoverflow.com/questions/51187973 + sh := (*reflect.SliceHeader)(unsafe.Pointer(&buf)) + sh.Data = uintptr(unsafe.Pointer(&raw.FileName)) + sh.Len = size + sh.Cap = size + name := windows.UTF16ToString(buf) + fullname := filepath.Join(watch.path, name) + + var mask uint64 + switch raw.Action { + case windows.FILE_ACTION_REMOVED: + mask = sysFSDELETESELF + case windows.FILE_ACTION_MODIFIED: + mask = sysFSMODIFY + case windows.FILE_ACTION_RENAMED_OLD_NAME: + watch.rename = name + case windows.FILE_ACTION_RENAMED_NEW_NAME: + // Update saved path of all sub-watches. + old := filepath.Join(watch.path, watch.rename) + w.mu.Lock() + for _, watchMap := range w.watches { + for _, ww := range watchMap { + if strings.HasPrefix(ww.path, old) { + ww.path = filepath.Join(fullname, strings.TrimPrefix(ww.path, old)) + } + } + } + w.mu.Unlock() + + if watch.names[watch.rename] != 0 { + watch.names[name] |= watch.names[watch.rename] + delete(watch.names, watch.rename) + mask = sysFSMOVESELF + } + } + + sendNameEvent := func() { + w.sendEvent(fullname, watch.names[name]&mask) + } + if raw.Action != windows.FILE_ACTION_RENAMED_NEW_NAME { + sendNameEvent() + } + if raw.Action == windows.FILE_ACTION_REMOVED { + w.sendEvent(fullname, watch.names[name]&sysFSIGNORED) + delete(watch.names, name) + } + + w.sendEvent(fullname, watch.mask&w.toFSnotifyFlags(raw.Action)) + if raw.Action == windows.FILE_ACTION_RENAMED_NEW_NAME { + fullname = filepath.Join(watch.path, watch.rename) + sendNameEvent() + } + + // Move to the next event in the buffer + if raw.NextEntryOffset == 0 { + break + } + offset += raw.NextEntryOffset + + // Error! + if offset >= n { + w.sendError(errors.New( + "Windows system assumed buffer larger than it is, events have likely been missed.")) + break + } + } + + if err := w.startRead(watch); err != nil { + w.sendError(err) + } + } +} + +func (w *Watcher) toWindowsFlags(mask uint64) uint32 { + var m uint32 + if mask&sysFSMODIFY != 0 { + m |= windows.FILE_NOTIFY_CHANGE_LAST_WRITE + } + if mask&sysFSATTRIB != 0 { + m |= windows.FILE_NOTIFY_CHANGE_ATTRIBUTES + } + if mask&(sysFSMOVE|sysFSCREATE|sysFSDELETE) != 0 { + m |= windows.FILE_NOTIFY_CHANGE_FILE_NAME | windows.FILE_NOTIFY_CHANGE_DIR_NAME + } + return m +} + +func (w *Watcher) toFSnotifyFlags(action uint32) uint64 { + switch action { + case windows.FILE_ACTION_ADDED: + return sysFSCREATE + case windows.FILE_ACTION_REMOVED: + return sysFSDELETE + case windows.FILE_ACTION_MODIFIED: + return sysFSMODIFY + case windows.FILE_ACTION_RENAMED_OLD_NAME: + return sysFSMOVEDFROM + case windows.FILE_ACTION_RENAMED_NEW_NAME: + return sysFSMOVEDTO + } + return 0 +} diff --git a/vendor/github.com/fsnotify/fsnotify/fen.go b/vendor/github.com/fsnotify/fsnotify/fen.go deleted file mode 100644 index ced39cb..0000000 --- a/vendor/github.com/fsnotify/fsnotify/fen.go +++ /dev/null @@ -1,37 +0,0 @@ -// Copyright 2010 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build solaris - -package fsnotify - -import ( - "errors" -) - -// Watcher watches a set of files, delivering events to a channel. -type Watcher struct { - Events chan Event - Errors chan error -} - -// NewWatcher establishes a new watcher with the underlying OS and begins waiting for events. -func NewWatcher() (*Watcher, error) { - return nil, errors.New("FEN based watcher not yet supported for fsnotify\n") -} - -// Close removes all watches and closes the events channel. -func (w *Watcher) Close() error { - return nil -} - -// Add starts watching the named file or directory (non-recursively). -func (w *Watcher) Add(name string) error { - return nil -} - -// Remove stops watching the the named file or directory (non-recursively). -func (w *Watcher) Remove(name string) error { - return nil -} diff --git a/vendor/github.com/fsnotify/fsnotify/fsnotify.go b/vendor/github.com/fsnotify/fsnotify/fsnotify.go index 89cab04..30a5bf0 100644 --- a/vendor/github.com/fsnotify/fsnotify/fsnotify.go +++ b/vendor/github.com/fsnotify/fsnotify/fsnotify.go @@ -1,28 +1,37 @@ -// Copyright 2012 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - +//go:build !plan9 // +build !plan9 -// Package fsnotify provides a platform-independent interface for file system notifications. +// Package fsnotify provides a cross-platform interface for file system +// notifications. package fsnotify import ( - "bytes" "errors" "fmt" + "strings" ) -// Event represents a single file system notification. +// Event represents a file system notification. type Event struct { - Name string // Relative path to the file or directory. - Op Op // File operation that triggered the event. + // Path to the file or directory. + // + // Paths are relative to the input; for example with Add("dir") the Name + // will be set to "dir/file" if you create that file, but if you use + // Add("/path/to/dir") it will be "/path/to/dir/file". + Name string + + // File operation that triggered the event. + // + // This is a bitmask and some systems may send multiple operations at once. + // Use the Event.Has() method instead of comparing with ==. + Op Op } // Op describes a set of file operations. type Op uint32 -// These are the generalized file operations that can trigger a notification. +// The operations fsnotify can trigger; see the documentation on [Watcher] for a +// full description, and check them with [Event.Has]. const ( Create Op = 1 << iota Write @@ -31,38 +40,42 @@ const ( Chmod ) -func (op Op) String() string { - // Use a buffer for efficient string concatenation - var buffer bytes.Buffer +// Common errors that can be reported by a watcher +var ( + ErrNonExistentWatch = errors.New("can't remove non-existent watcher") + ErrEventOverflow = errors.New("fsnotify queue overflow") +) - if op&Create == Create { - buffer.WriteString("|CREATE") +func (op Op) String() string { + var b strings.Builder + if op.Has(Create) { + b.WriteString("|CREATE") } - if op&Remove == Remove { - buffer.WriteString("|REMOVE") + if op.Has(Remove) { + b.WriteString("|REMOVE") } - if op&Write == Write { - buffer.WriteString("|WRITE") + if op.Has(Write) { + b.WriteString("|WRITE") } - if op&Rename == Rename { - buffer.WriteString("|RENAME") + if op.Has(Rename) { + b.WriteString("|RENAME") } - if op&Chmod == Chmod { - buffer.WriteString("|CHMOD") + if op.Has(Chmod) { + b.WriteString("|CHMOD") } - if buffer.Len() == 0 { - return "" + if b.Len() == 0 { + return "[no events]" } - return buffer.String()[1:] // Strip leading pipe + return b.String()[1:] } -// String returns a string representation of the event in the form -// "file: REMOVE|WRITE|..." +// Has reports if this operation has the given operation. +func (o Op) Has(h Op) bool { return o&h == h } + +// Has reports if this event has the given operation. +func (e Event) Has(op Op) bool { return e.Op.Has(op) } + +// String returns a string representation of the event with their path. func (e Event) String() string { - return fmt.Sprintf("%q: %s", e.Name, e.Op.String()) + return fmt.Sprintf("%-13s %q", e.Op.String(), e.Name) } - -// Common errors that can be reported by a watcher -var ( - ErrEventOverflow = errors.New("fsnotify queue overflow") -) diff --git a/vendor/github.com/fsnotify/fsnotify/inotify.go b/vendor/github.com/fsnotify/fsnotify/inotify.go deleted file mode 100644 index d9fd1b8..0000000 --- a/vendor/github.com/fsnotify/fsnotify/inotify.go +++ /dev/null @@ -1,337 +0,0 @@ -// Copyright 2010 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build linux - -package fsnotify - -import ( - "errors" - "fmt" - "io" - "os" - "path/filepath" - "strings" - "sync" - "unsafe" - - "golang.org/x/sys/unix" -) - -// Watcher watches a set of files, delivering events to a channel. -type Watcher struct { - Events chan Event - Errors chan error - mu sync.Mutex // Map access - fd int - poller *fdPoller - watches map[string]*watch // Map of inotify watches (key: path) - paths map[int]string // Map of watched paths (key: watch descriptor) - done chan struct{} // Channel for sending a "quit message" to the reader goroutine - doneResp chan struct{} // Channel to respond to Close -} - -// NewWatcher establishes a new watcher with the underlying OS and begins waiting for events. -func NewWatcher() (*Watcher, error) { - // Create inotify fd - fd, errno := unix.InotifyInit1(unix.IN_CLOEXEC) - if fd == -1 { - return nil, errno - } - // Create epoll - poller, err := newFdPoller(fd) - if err != nil { - unix.Close(fd) - return nil, err - } - w := &Watcher{ - fd: fd, - poller: poller, - watches: make(map[string]*watch), - paths: make(map[int]string), - Events: make(chan Event), - Errors: make(chan error), - done: make(chan struct{}), - doneResp: make(chan struct{}), - } - - go w.readEvents() - return w, nil -} - -func (w *Watcher) isClosed() bool { - select { - case <-w.done: - return true - default: - return false - } -} - -// Close removes all watches and closes the events channel. -func (w *Watcher) Close() error { - if w.isClosed() { - return nil - } - - // Send 'close' signal to goroutine, and set the Watcher to closed. - close(w.done) - - // Wake up goroutine - w.poller.wake() - - // Wait for goroutine to close - <-w.doneResp - - return nil -} - -// Add starts watching the named file or directory (non-recursively). -func (w *Watcher) Add(name string) error { - name = filepath.Clean(name) - if w.isClosed() { - return errors.New("inotify instance already closed") - } - - const agnosticEvents = unix.IN_MOVED_TO | unix.IN_MOVED_FROM | - unix.IN_CREATE | unix.IN_ATTRIB | unix.IN_MODIFY | - unix.IN_MOVE_SELF | unix.IN_DELETE | unix.IN_DELETE_SELF - - var flags uint32 = agnosticEvents - - w.mu.Lock() - defer w.mu.Unlock() - watchEntry := w.watches[name] - if watchEntry != nil { - flags |= watchEntry.flags | unix.IN_MASK_ADD - } - wd, errno := unix.InotifyAddWatch(w.fd, name, flags) - if wd == -1 { - return errno - } - - if watchEntry == nil { - w.watches[name] = &watch{wd: uint32(wd), flags: flags} - w.paths[wd] = name - } else { - watchEntry.wd = uint32(wd) - watchEntry.flags = flags - } - - return nil -} - -// Remove stops watching the named file or directory (non-recursively). -func (w *Watcher) Remove(name string) error { - name = filepath.Clean(name) - - // Fetch the watch. - w.mu.Lock() - defer w.mu.Unlock() - watch, ok := w.watches[name] - - // Remove it from inotify. - if !ok { - return fmt.Errorf("can't remove non-existent inotify watch for: %s", name) - } - - // We successfully removed the watch if InotifyRmWatch doesn't return an - // error, we need to clean up our internal state to ensure it matches - // inotify's kernel state. - delete(w.paths, int(watch.wd)) - delete(w.watches, name) - - // inotify_rm_watch will return EINVAL if the file has been deleted; - // the inotify will already have been removed. - // watches and pathes are deleted in ignoreLinux() implicitly and asynchronously - // by calling inotify_rm_watch() below. e.g. readEvents() goroutine receives IN_IGNORE - // so that EINVAL means that the wd is being rm_watch()ed or its file removed - // by another thread and we have not received IN_IGNORE event. - success, errno := unix.InotifyRmWatch(w.fd, watch.wd) - if success == -1 { - // TODO: Perhaps it's not helpful to return an error here in every case. - // the only two possible errors are: - // EBADF, which happens when w.fd is not a valid file descriptor of any kind. - // EINVAL, which is when fd is not an inotify descriptor or wd is not a valid watch descriptor. - // Watch descriptors are invalidated when they are removed explicitly or implicitly; - // explicitly by inotify_rm_watch, implicitly when the file they are watching is deleted. - return errno - } - - return nil -} - -type watch struct { - wd uint32 // Watch descriptor (as returned by the inotify_add_watch() syscall) - flags uint32 // inotify flags of this watch (see inotify(7) for the list of valid flags) -} - -// readEvents reads from the inotify file descriptor, converts the -// received events into Event objects and sends them via the Events channel -func (w *Watcher) readEvents() { - var ( - buf [unix.SizeofInotifyEvent * 4096]byte // Buffer for a maximum of 4096 raw events - n int // Number of bytes read with read() - errno error // Syscall errno - ok bool // For poller.wait - ) - - defer close(w.doneResp) - defer close(w.Errors) - defer close(w.Events) - defer unix.Close(w.fd) - defer w.poller.close() - - for { - // See if we have been closed. - if w.isClosed() { - return - } - - ok, errno = w.poller.wait() - if errno != nil { - select { - case w.Errors <- errno: - case <-w.done: - return - } - continue - } - - if !ok { - continue - } - - n, errno = unix.Read(w.fd, buf[:]) - // If a signal interrupted execution, see if we've been asked to close, and try again. - // http://man7.org/linux/man-pages/man7/signal.7.html : - // "Before Linux 3.8, reads from an inotify(7) file descriptor were not restartable" - if errno == unix.EINTR { - continue - } - - // unix.Read might have been woken up by Close. If so, we're done. - if w.isClosed() { - return - } - - if n < unix.SizeofInotifyEvent { - var err error - if n == 0 { - // If EOF is received. This should really never happen. - err = io.EOF - } else if n < 0 { - // If an error occurred while reading. - err = errno - } else { - // Read was too short. - err = errors.New("notify: short read in readEvents()") - } - select { - case w.Errors <- err: - case <-w.done: - return - } - continue - } - - var offset uint32 - // We don't know how many events we just read into the buffer - // While the offset points to at least one whole event... - for offset <= uint32(n-unix.SizeofInotifyEvent) { - // Point "raw" to the event in the buffer - raw := (*unix.InotifyEvent)(unsafe.Pointer(&buf[offset])) - - mask := uint32(raw.Mask) - nameLen := uint32(raw.Len) - - if mask&unix.IN_Q_OVERFLOW != 0 { - select { - case w.Errors <- ErrEventOverflow: - case <-w.done: - return - } - } - - // If the event happened to the watched directory or the watched file, the kernel - // doesn't append the filename to the event, but we would like to always fill the - // the "Name" field with a valid filename. We retrieve the path of the watch from - // the "paths" map. - w.mu.Lock() - name, ok := w.paths[int(raw.Wd)] - // IN_DELETE_SELF occurs when the file/directory being watched is removed. - // This is a sign to clean up the maps, otherwise we are no longer in sync - // with the inotify kernel state which has already deleted the watch - // automatically. - if ok && mask&unix.IN_DELETE_SELF == unix.IN_DELETE_SELF { - delete(w.paths, int(raw.Wd)) - delete(w.watches, name) - } - w.mu.Unlock() - - if nameLen > 0 { - // Point "bytes" at the first byte of the filename - bytes := (*[unix.PathMax]byte)(unsafe.Pointer(&buf[offset+unix.SizeofInotifyEvent])) - // The filename is padded with NULL bytes. TrimRight() gets rid of those. - name += "/" + strings.TrimRight(string(bytes[0:nameLen]), "\000") - } - - event := newEvent(name, mask) - - // Send the events that are not ignored on the events channel - if !event.ignoreLinux(mask) { - select { - case w.Events <- event: - case <-w.done: - return - } - } - - // Move to the next event in the buffer - offset += unix.SizeofInotifyEvent + nameLen - } - } -} - -// Certain types of events can be "ignored" and not sent over the Events -// channel. Such as events marked ignore by the kernel, or MODIFY events -// against files that do not exist. -func (e *Event) ignoreLinux(mask uint32) bool { - // Ignore anything the inotify API says to ignore - if mask&unix.IN_IGNORED == unix.IN_IGNORED { - return true - } - - // If the event is not a DELETE or RENAME, the file must exist. - // Otherwise the event is ignored. - // *Note*: this was put in place because it was seen that a MODIFY - // event was sent after the DELETE. This ignores that MODIFY and - // assumes a DELETE will come or has come if the file doesn't exist. - if !(e.Op&Remove == Remove || e.Op&Rename == Rename) { - _, statErr := os.Lstat(e.Name) - return os.IsNotExist(statErr) - } - return false -} - -// newEvent returns an platform-independent Event based on an inotify mask. -func newEvent(name string, mask uint32) Event { - e := Event{Name: name} - if mask&unix.IN_CREATE == unix.IN_CREATE || mask&unix.IN_MOVED_TO == unix.IN_MOVED_TO { - e.Op |= Create - } - if mask&unix.IN_DELETE_SELF == unix.IN_DELETE_SELF || mask&unix.IN_DELETE == unix.IN_DELETE { - e.Op |= Remove - } - if mask&unix.IN_MODIFY == unix.IN_MODIFY { - e.Op |= Write - } - if mask&unix.IN_MOVE_SELF == unix.IN_MOVE_SELF || mask&unix.IN_MOVED_FROM == unix.IN_MOVED_FROM { - e.Op |= Rename - } - if mask&unix.IN_ATTRIB == unix.IN_ATTRIB { - e.Op |= Chmod - } - return e -} diff --git a/vendor/github.com/fsnotify/fsnotify/inotify_poller.go b/vendor/github.com/fsnotify/fsnotify/inotify_poller.go deleted file mode 100644 index b33f2b4..0000000 --- a/vendor/github.com/fsnotify/fsnotify/inotify_poller.go +++ /dev/null @@ -1,187 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build linux - -package fsnotify - -import ( - "errors" - - "golang.org/x/sys/unix" -) - -type fdPoller struct { - fd int // File descriptor (as returned by the inotify_init() syscall) - epfd int // Epoll file descriptor - pipe [2]int // Pipe for waking up -} - -func emptyPoller(fd int) *fdPoller { - poller := new(fdPoller) - poller.fd = fd - poller.epfd = -1 - poller.pipe[0] = -1 - poller.pipe[1] = -1 - return poller -} - -// Create a new inotify poller. -// This creates an inotify handler, and an epoll handler. -func newFdPoller(fd int) (*fdPoller, error) { - var errno error - poller := emptyPoller(fd) - defer func() { - if errno != nil { - poller.close() - } - }() - poller.fd = fd - - // Create epoll fd - poller.epfd, errno = unix.EpollCreate1(unix.EPOLL_CLOEXEC) - if poller.epfd == -1 { - return nil, errno - } - // Create pipe; pipe[0] is the read end, pipe[1] the write end. - errno = unix.Pipe2(poller.pipe[:], unix.O_NONBLOCK|unix.O_CLOEXEC) - if errno != nil { - return nil, errno - } - - // Register inotify fd with epoll - event := unix.EpollEvent{ - Fd: int32(poller.fd), - Events: unix.EPOLLIN, - } - errno = unix.EpollCtl(poller.epfd, unix.EPOLL_CTL_ADD, poller.fd, &event) - if errno != nil { - return nil, errno - } - - // Register pipe fd with epoll - event = unix.EpollEvent{ - Fd: int32(poller.pipe[0]), - Events: unix.EPOLLIN, - } - errno = unix.EpollCtl(poller.epfd, unix.EPOLL_CTL_ADD, poller.pipe[0], &event) - if errno != nil { - return nil, errno - } - - return poller, nil -} - -// Wait using epoll. -// Returns true if something is ready to be read, -// false if there is not. -func (poller *fdPoller) wait() (bool, error) { - // 3 possible events per fd, and 2 fds, makes a maximum of 6 events. - // I don't know whether epoll_wait returns the number of events returned, - // or the total number of events ready. - // I decided to catch both by making the buffer one larger than the maximum. - events := make([]unix.EpollEvent, 7) - for { - n, errno := unix.EpollWait(poller.epfd, events, -1) - if n == -1 { - if errno == unix.EINTR { - continue - } - return false, errno - } - if n == 0 { - // If there are no events, try again. - continue - } - if n > 6 { - // This should never happen. More events were returned than should be possible. - return false, errors.New("epoll_wait returned more events than I know what to do with") - } - ready := events[:n] - epollhup := false - epollerr := false - epollin := false - for _, event := range ready { - if event.Fd == int32(poller.fd) { - if event.Events&unix.EPOLLHUP != 0 { - // This should not happen, but if it does, treat it as a wakeup. - epollhup = true - } - if event.Events&unix.EPOLLERR != 0 { - // If an error is waiting on the file descriptor, we should pretend - // something is ready to read, and let unix.Read pick up the error. - epollerr = true - } - if event.Events&unix.EPOLLIN != 0 { - // There is data to read. - epollin = true - } - } - if event.Fd == int32(poller.pipe[0]) { - if event.Events&unix.EPOLLHUP != 0 { - // Write pipe descriptor was closed, by us. This means we're closing down the - // watcher, and we should wake up. - } - if event.Events&unix.EPOLLERR != 0 { - // If an error is waiting on the pipe file descriptor. - // This is an absolute mystery, and should never ever happen. - return false, errors.New("Error on the pipe descriptor.") - } - if event.Events&unix.EPOLLIN != 0 { - // This is a regular wakeup, so we have to clear the buffer. - err := poller.clearWake() - if err != nil { - return false, err - } - } - } - } - - if epollhup || epollerr || epollin { - return true, nil - } - return false, nil - } -} - -// Close the write end of the poller. -func (poller *fdPoller) wake() error { - buf := make([]byte, 1) - n, errno := unix.Write(poller.pipe[1], buf) - if n == -1 { - if errno == unix.EAGAIN { - // Buffer is full, poller will wake. - return nil - } - return errno - } - return nil -} - -func (poller *fdPoller) clearWake() error { - // You have to be woken up a LOT in order to get to 100! - buf := make([]byte, 100) - n, errno := unix.Read(poller.pipe[0], buf) - if n == -1 { - if errno == unix.EAGAIN { - // Buffer is empty, someone else cleared our wake. - return nil - } - return errno - } - return nil -} - -// Close all poller file descriptors, but not the one passed to it. -func (poller *fdPoller) close() { - if poller.pipe[1] != -1 { - unix.Close(poller.pipe[1]) - } - if poller.pipe[0] != -1 { - unix.Close(poller.pipe[0]) - } - if poller.epfd != -1 { - unix.Close(poller.epfd) - } -} diff --git a/vendor/github.com/fsnotify/fsnotify/kqueue.go b/vendor/github.com/fsnotify/fsnotify/kqueue.go deleted file mode 100644 index 86e76a3..0000000 --- a/vendor/github.com/fsnotify/fsnotify/kqueue.go +++ /dev/null @@ -1,521 +0,0 @@ -// Copyright 2010 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build freebsd openbsd netbsd dragonfly darwin - -package fsnotify - -import ( - "errors" - "fmt" - "io/ioutil" - "os" - "path/filepath" - "sync" - "time" - - "golang.org/x/sys/unix" -) - -// Watcher watches a set of files, delivering events to a channel. -type Watcher struct { - Events chan Event - Errors chan error - done chan struct{} // Channel for sending a "quit message" to the reader goroutine - - kq int // File descriptor (as returned by the kqueue() syscall). - - mu sync.Mutex // Protects access to watcher data - watches map[string]int // Map of watched file descriptors (key: path). - externalWatches map[string]bool // Map of watches added by user of the library. - dirFlags map[string]uint32 // Map of watched directories to fflags used in kqueue. - paths map[int]pathInfo // Map file descriptors to path names for processing kqueue events. - fileExists map[string]bool // Keep track of if we know this file exists (to stop duplicate create events). - isClosed bool // Set to true when Close() is first called -} - -type pathInfo struct { - name string - isDir bool -} - -// NewWatcher establishes a new watcher with the underlying OS and begins waiting for events. -func NewWatcher() (*Watcher, error) { - kq, err := kqueue() - if err != nil { - return nil, err - } - - w := &Watcher{ - kq: kq, - watches: make(map[string]int), - dirFlags: make(map[string]uint32), - paths: make(map[int]pathInfo), - fileExists: make(map[string]bool), - externalWatches: make(map[string]bool), - Events: make(chan Event), - Errors: make(chan error), - done: make(chan struct{}), - } - - go w.readEvents() - return w, nil -} - -// Close removes all watches and closes the events channel. -func (w *Watcher) Close() error { - w.mu.Lock() - if w.isClosed { - w.mu.Unlock() - return nil - } - w.isClosed = true - - // copy paths to remove while locked - var pathsToRemove = make([]string, 0, len(w.watches)) - for name := range w.watches { - pathsToRemove = append(pathsToRemove, name) - } - w.mu.Unlock() - // unlock before calling Remove, which also locks - - for _, name := range pathsToRemove { - w.Remove(name) - } - - // send a "quit" message to the reader goroutine - close(w.done) - - return nil -} - -// Add starts watching the named file or directory (non-recursively). -func (w *Watcher) Add(name string) error { - w.mu.Lock() - w.externalWatches[name] = true - w.mu.Unlock() - _, err := w.addWatch(name, noteAllEvents) - return err -} - -// Remove stops watching the the named file or directory (non-recursively). -func (w *Watcher) Remove(name string) error { - name = filepath.Clean(name) - w.mu.Lock() - watchfd, ok := w.watches[name] - w.mu.Unlock() - if !ok { - return fmt.Errorf("can't remove non-existent kevent watch for: %s", name) - } - - const registerRemove = unix.EV_DELETE - if err := register(w.kq, []int{watchfd}, registerRemove, 0); err != nil { - return err - } - - unix.Close(watchfd) - - w.mu.Lock() - isDir := w.paths[watchfd].isDir - delete(w.watches, name) - delete(w.paths, watchfd) - delete(w.dirFlags, name) - w.mu.Unlock() - - // Find all watched paths that are in this directory that are not external. - if isDir { - var pathsToRemove []string - w.mu.Lock() - for _, path := range w.paths { - wdir, _ := filepath.Split(path.name) - if filepath.Clean(wdir) == name { - if !w.externalWatches[path.name] { - pathsToRemove = append(pathsToRemove, path.name) - } - } - } - w.mu.Unlock() - for _, name := range pathsToRemove { - // Since these are internal, not much sense in propagating error - // to the user, as that will just confuse them with an error about - // a path they did not explicitly watch themselves. - w.Remove(name) - } - } - - return nil -} - -// Watch all events (except NOTE_EXTEND, NOTE_LINK, NOTE_REVOKE) -const noteAllEvents = unix.NOTE_DELETE | unix.NOTE_WRITE | unix.NOTE_ATTRIB | unix.NOTE_RENAME - -// keventWaitTime to block on each read from kevent -var keventWaitTime = durationToTimespec(100 * time.Millisecond) - -// addWatch adds name to the watched file set. -// The flags are interpreted as described in kevent(2). -// Returns the real path to the file which was added, if any, which may be different from the one passed in the case of symlinks. -func (w *Watcher) addWatch(name string, flags uint32) (string, error) { - var isDir bool - // Make ./name and name equivalent - name = filepath.Clean(name) - - w.mu.Lock() - if w.isClosed { - w.mu.Unlock() - return "", errors.New("kevent instance already closed") - } - watchfd, alreadyWatching := w.watches[name] - // We already have a watch, but we can still override flags. - if alreadyWatching { - isDir = w.paths[watchfd].isDir - } - w.mu.Unlock() - - if !alreadyWatching { - fi, err := os.Lstat(name) - if err != nil { - return "", err - } - - // Don't watch sockets. - if fi.Mode()&os.ModeSocket == os.ModeSocket { - return "", nil - } - - // Don't watch named pipes. - if fi.Mode()&os.ModeNamedPipe == os.ModeNamedPipe { - return "", nil - } - - // Follow Symlinks - // Unfortunately, Linux can add bogus symlinks to watch list without - // issue, and Windows can't do symlinks period (AFAIK). To maintain - // consistency, we will act like everything is fine. There will simply - // be no file events for broken symlinks. - // Hence the returns of nil on errors. - if fi.Mode()&os.ModeSymlink == os.ModeSymlink { - name, err = filepath.EvalSymlinks(name) - if err != nil { - return "", nil - } - - w.mu.Lock() - _, alreadyWatching = w.watches[name] - w.mu.Unlock() - - if alreadyWatching { - return name, nil - } - - fi, err = os.Lstat(name) - if err != nil { - return "", nil - } - } - - watchfd, err = unix.Open(name, openMode, 0700) - if watchfd == -1 { - return "", err - } - - isDir = fi.IsDir() - } - - const registerAdd = unix.EV_ADD | unix.EV_CLEAR | unix.EV_ENABLE - if err := register(w.kq, []int{watchfd}, registerAdd, flags); err != nil { - unix.Close(watchfd) - return "", err - } - - if !alreadyWatching { - w.mu.Lock() - w.watches[name] = watchfd - w.paths[watchfd] = pathInfo{name: name, isDir: isDir} - w.mu.Unlock() - } - - if isDir { - // Watch the directory if it has not been watched before, - // or if it was watched before, but perhaps only a NOTE_DELETE (watchDirectoryFiles) - w.mu.Lock() - - watchDir := (flags&unix.NOTE_WRITE) == unix.NOTE_WRITE && - (!alreadyWatching || (w.dirFlags[name]&unix.NOTE_WRITE) != unix.NOTE_WRITE) - // Store flags so this watch can be updated later - w.dirFlags[name] = flags - w.mu.Unlock() - - if watchDir { - if err := w.watchDirectoryFiles(name); err != nil { - return "", err - } - } - } - return name, nil -} - -// readEvents reads from kqueue and converts the received kevents into -// Event values that it sends down the Events channel. -func (w *Watcher) readEvents() { - eventBuffer := make([]unix.Kevent_t, 10) - -loop: - for { - // See if there is a message on the "done" channel - select { - case <-w.done: - break loop - default: - } - - // Get new events - kevents, err := read(w.kq, eventBuffer, &keventWaitTime) - // EINTR is okay, the syscall was interrupted before timeout expired. - if err != nil && err != unix.EINTR { - select { - case w.Errors <- err: - case <-w.done: - break loop - } - continue - } - - // Flush the events we received to the Events channel - for len(kevents) > 0 { - kevent := &kevents[0] - watchfd := int(kevent.Ident) - mask := uint32(kevent.Fflags) - w.mu.Lock() - path := w.paths[watchfd] - w.mu.Unlock() - event := newEvent(path.name, mask) - - if path.isDir && !(event.Op&Remove == Remove) { - // Double check to make sure the directory exists. This can happen when - // we do a rm -fr on a recursively watched folders and we receive a - // modification event first but the folder has been deleted and later - // receive the delete event - if _, err := os.Lstat(event.Name); os.IsNotExist(err) { - // mark is as delete event - event.Op |= Remove - } - } - - if event.Op&Rename == Rename || event.Op&Remove == Remove { - w.Remove(event.Name) - w.mu.Lock() - delete(w.fileExists, event.Name) - w.mu.Unlock() - } - - if path.isDir && event.Op&Write == Write && !(event.Op&Remove == Remove) { - w.sendDirectoryChangeEvents(event.Name) - } else { - // Send the event on the Events channel. - select { - case w.Events <- event: - case <-w.done: - break loop - } - } - - if event.Op&Remove == Remove { - // Look for a file that may have overwritten this. - // For example, mv f1 f2 will delete f2, then create f2. - if path.isDir { - fileDir := filepath.Clean(event.Name) - w.mu.Lock() - _, found := w.watches[fileDir] - w.mu.Unlock() - if found { - // make sure the directory exists before we watch for changes. When we - // do a recursive watch and perform rm -fr, the parent directory might - // have gone missing, ignore the missing directory and let the - // upcoming delete event remove the watch from the parent directory. - if _, err := os.Lstat(fileDir); err == nil { - w.sendDirectoryChangeEvents(fileDir) - } - } - } else { - filePath := filepath.Clean(event.Name) - if fileInfo, err := os.Lstat(filePath); err == nil { - w.sendFileCreatedEventIfNew(filePath, fileInfo) - } - } - } - - // Move to next event - kevents = kevents[1:] - } - } - - // cleanup - err := unix.Close(w.kq) - if err != nil { - // only way the previous loop breaks is if w.done was closed so we need to async send to w.Errors. - select { - case w.Errors <- err: - default: - } - } - close(w.Events) - close(w.Errors) -} - -// newEvent returns an platform-independent Event based on kqueue Fflags. -func newEvent(name string, mask uint32) Event { - e := Event{Name: name} - if mask&unix.NOTE_DELETE == unix.NOTE_DELETE { - e.Op |= Remove - } - if mask&unix.NOTE_WRITE == unix.NOTE_WRITE { - e.Op |= Write - } - if mask&unix.NOTE_RENAME == unix.NOTE_RENAME { - e.Op |= Rename - } - if mask&unix.NOTE_ATTRIB == unix.NOTE_ATTRIB { - e.Op |= Chmod - } - return e -} - -func newCreateEvent(name string) Event { - return Event{Name: name, Op: Create} -} - -// watchDirectoryFiles to mimic inotify when adding a watch on a directory -func (w *Watcher) watchDirectoryFiles(dirPath string) error { - // Get all files - files, err := ioutil.ReadDir(dirPath) - if err != nil { - return err - } - - for _, fileInfo := range files { - filePath := filepath.Join(dirPath, fileInfo.Name()) - filePath, err = w.internalWatch(filePath, fileInfo) - if err != nil { - return err - } - - w.mu.Lock() - w.fileExists[filePath] = true - w.mu.Unlock() - } - - return nil -} - -// sendDirectoryEvents searches the directory for newly created files -// and sends them over the event channel. This functionality is to have -// the BSD version of fsnotify match Linux inotify which provides a -// create event for files created in a watched directory. -func (w *Watcher) sendDirectoryChangeEvents(dirPath string) { - // Get all files - files, err := ioutil.ReadDir(dirPath) - if err != nil { - select { - case w.Errors <- err: - case <-w.done: - return - } - } - - // Search for new files - for _, fileInfo := range files { - filePath := filepath.Join(dirPath, fileInfo.Name()) - err := w.sendFileCreatedEventIfNew(filePath, fileInfo) - - if err != nil { - return - } - } -} - -// sendFileCreatedEvent sends a create event if the file isn't already being tracked. -func (w *Watcher) sendFileCreatedEventIfNew(filePath string, fileInfo os.FileInfo) (err error) { - w.mu.Lock() - _, doesExist := w.fileExists[filePath] - w.mu.Unlock() - if !doesExist { - // Send create event - select { - case w.Events <- newCreateEvent(filePath): - case <-w.done: - return - } - } - - // like watchDirectoryFiles (but without doing another ReadDir) - filePath, err = w.internalWatch(filePath, fileInfo) - if err != nil { - return err - } - - w.mu.Lock() - w.fileExists[filePath] = true - w.mu.Unlock() - - return nil -} - -func (w *Watcher) internalWatch(name string, fileInfo os.FileInfo) (string, error) { - if fileInfo.IsDir() { - // mimic Linux providing delete events for subdirectories - // but preserve the flags used if currently watching subdirectory - w.mu.Lock() - flags := w.dirFlags[name] - w.mu.Unlock() - - flags |= unix.NOTE_DELETE | unix.NOTE_RENAME - return w.addWatch(name, flags) - } - - // watch file to mimic Linux inotify - return w.addWatch(name, noteAllEvents) -} - -// kqueue creates a new kernel event queue and returns a descriptor. -func kqueue() (kq int, err error) { - kq, err = unix.Kqueue() - if kq == -1 { - return kq, err - } - return kq, nil -} - -// register events with the queue -func register(kq int, fds []int, flags int, fflags uint32) error { - changes := make([]unix.Kevent_t, len(fds)) - - for i, fd := range fds { - // SetKevent converts int to the platform-specific types: - unix.SetKevent(&changes[i], fd, unix.EVFILT_VNODE, flags) - changes[i].Fflags = fflags - } - - // register the events - success, err := unix.Kevent(kq, changes, nil, nil) - if success == -1 { - return err - } - return nil -} - -// read retrieves pending events, or waits until an event occurs. -// A timeout of nil blocks indefinitely, while 0 polls the queue. -func read(kq int, events []unix.Kevent_t, timeout *unix.Timespec) ([]unix.Kevent_t, error) { - n, err := unix.Kevent(kq, nil, events, timeout) - if err != nil { - return nil, err - } - return events[0:n], nil -} - -// durationToTimespec prepares a timeout value -func durationToTimespec(d time.Duration) unix.Timespec { - return unix.NsecToTimespec(d.Nanoseconds()) -} diff --git a/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh b/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh new file mode 100644 index 0000000..b09ef76 --- /dev/null +++ b/vendor/github.com/fsnotify/fsnotify/mkdoc.zsh @@ -0,0 +1,208 @@ +#!/usr/bin/env zsh +[ "${ZSH_VERSION:-}" = "" ] && echo >&2 "Only works with zsh" && exit 1 +setopt err_exit no_unset pipefail extended_glob + +# Simple script to update the godoc comments on all watchers. Probably took me +# more time to write this than doing it manually, but ah well 🙃 + +watcher=$(</tmp/x + print -r -- $cmt >>/tmp/x + tail -n+$(( end + 1 )) $file >>/tmp/x + mv /tmp/x $file + done +} + +set-cmt '^type Watcher struct ' $watcher +set-cmt '^func NewWatcher(' $new +set-cmt '^func (w \*Watcher) Add(' $add +set-cmt '^func (w \*Watcher) Remove(' $remove +set-cmt '^func (w \*Watcher) Close(' $close +set-cmt '^func (w \*Watcher) WatchList(' $watchlist +set-cmt '^[[:space:]]*Events *chan Event$' $events +set-cmt '^[[:space:]]*Errors *chan error$' $errors diff --git a/vendor/github.com/fsnotify/fsnotify/open_mode_bsd.go b/vendor/github.com/fsnotify/fsnotify/system_bsd.go similarity index 50% rename from vendor/github.com/fsnotify/fsnotify/open_mode_bsd.go rename to vendor/github.com/fsnotify/fsnotify/system_bsd.go index 2306c46..4322b0b 100644 --- a/vendor/github.com/fsnotify/fsnotify/open_mode_bsd.go +++ b/vendor/github.com/fsnotify/fsnotify/system_bsd.go @@ -1,7 +1,4 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - +//go:build freebsd || openbsd || netbsd || dragonfly // +build freebsd openbsd netbsd dragonfly package fsnotify diff --git a/vendor/github.com/fsnotify/fsnotify/open_mode_darwin.go b/vendor/github.com/fsnotify/fsnotify/system_darwin.go similarity index 50% rename from vendor/github.com/fsnotify/fsnotify/open_mode_darwin.go rename to vendor/github.com/fsnotify/fsnotify/system_darwin.go index 870c4d6..5da5ffa 100644 --- a/vendor/github.com/fsnotify/fsnotify/open_mode_darwin.go +++ b/vendor/github.com/fsnotify/fsnotify/system_darwin.go @@ -1,7 +1,4 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - +//go:build darwin // +build darwin package fsnotify diff --git a/vendor/github.com/fsnotify/fsnotify/windows.go b/vendor/github.com/fsnotify/fsnotify/windows.go deleted file mode 100644 index 09436f3..0000000 --- a/vendor/github.com/fsnotify/fsnotify/windows.go +++ /dev/null @@ -1,561 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build windows - -package fsnotify - -import ( - "errors" - "fmt" - "os" - "path/filepath" - "runtime" - "sync" - "syscall" - "unsafe" -) - -// Watcher watches a set of files, delivering events to a channel. -type Watcher struct { - Events chan Event - Errors chan error - isClosed bool // Set to true when Close() is first called - mu sync.Mutex // Map access - port syscall.Handle // Handle to completion port - watches watchMap // Map of watches (key: i-number) - input chan *input // Inputs to the reader are sent on this channel - quit chan chan<- error -} - -// NewWatcher establishes a new watcher with the underlying OS and begins waiting for events. -func NewWatcher() (*Watcher, error) { - port, e := syscall.CreateIoCompletionPort(syscall.InvalidHandle, 0, 0, 0) - if e != nil { - return nil, os.NewSyscallError("CreateIoCompletionPort", e) - } - w := &Watcher{ - port: port, - watches: make(watchMap), - input: make(chan *input, 1), - Events: make(chan Event, 50), - Errors: make(chan error), - quit: make(chan chan<- error, 1), - } - go w.readEvents() - return w, nil -} - -// Close removes all watches and closes the events channel. -func (w *Watcher) Close() error { - if w.isClosed { - return nil - } - w.isClosed = true - - // Send "quit" message to the reader goroutine - ch := make(chan error) - w.quit <- ch - if err := w.wakeupReader(); err != nil { - return err - } - return <-ch -} - -// Add starts watching the named file or directory (non-recursively). -func (w *Watcher) Add(name string) error { - if w.isClosed { - return errors.New("watcher already closed") - } - in := &input{ - op: opAddWatch, - path: filepath.Clean(name), - flags: sysFSALLEVENTS, - reply: make(chan error), - } - w.input <- in - if err := w.wakeupReader(); err != nil { - return err - } - return <-in.reply -} - -// Remove stops watching the the named file or directory (non-recursively). -func (w *Watcher) Remove(name string) error { - in := &input{ - op: opRemoveWatch, - path: filepath.Clean(name), - reply: make(chan error), - } - w.input <- in - if err := w.wakeupReader(); err != nil { - return err - } - return <-in.reply -} - -const ( - // Options for AddWatch - sysFSONESHOT = 0x80000000 - sysFSONLYDIR = 0x1000000 - - // Events - sysFSACCESS = 0x1 - sysFSALLEVENTS = 0xfff - sysFSATTRIB = 0x4 - sysFSCLOSE = 0x18 - sysFSCREATE = 0x100 - sysFSDELETE = 0x200 - sysFSDELETESELF = 0x400 - sysFSMODIFY = 0x2 - sysFSMOVE = 0xc0 - sysFSMOVEDFROM = 0x40 - sysFSMOVEDTO = 0x80 - sysFSMOVESELF = 0x800 - - // Special events - sysFSIGNORED = 0x8000 - sysFSQOVERFLOW = 0x4000 -) - -func newEvent(name string, mask uint32) Event { - e := Event{Name: name} - if mask&sysFSCREATE == sysFSCREATE || mask&sysFSMOVEDTO == sysFSMOVEDTO { - e.Op |= Create - } - if mask&sysFSDELETE == sysFSDELETE || mask&sysFSDELETESELF == sysFSDELETESELF { - e.Op |= Remove - } - if mask&sysFSMODIFY == sysFSMODIFY { - e.Op |= Write - } - if mask&sysFSMOVE == sysFSMOVE || mask&sysFSMOVESELF == sysFSMOVESELF || mask&sysFSMOVEDFROM == sysFSMOVEDFROM { - e.Op |= Rename - } - if mask&sysFSATTRIB == sysFSATTRIB { - e.Op |= Chmod - } - return e -} - -const ( - opAddWatch = iota - opRemoveWatch -) - -const ( - provisional uint64 = 1 << (32 + iota) -) - -type input struct { - op int - path string - flags uint32 - reply chan error -} - -type inode struct { - handle syscall.Handle - volume uint32 - index uint64 -} - -type watch struct { - ov syscall.Overlapped - ino *inode // i-number - path string // Directory path - mask uint64 // Directory itself is being watched with these notify flags - names map[string]uint64 // Map of names being watched and their notify flags - rename string // Remembers the old name while renaming a file - buf [4096]byte -} - -type indexMap map[uint64]*watch -type watchMap map[uint32]indexMap - -func (w *Watcher) wakeupReader() error { - e := syscall.PostQueuedCompletionStatus(w.port, 0, 0, nil) - if e != nil { - return os.NewSyscallError("PostQueuedCompletionStatus", e) - } - return nil -} - -func getDir(pathname string) (dir string, err error) { - attr, e := syscall.GetFileAttributes(syscall.StringToUTF16Ptr(pathname)) - if e != nil { - return "", os.NewSyscallError("GetFileAttributes", e) - } - if attr&syscall.FILE_ATTRIBUTE_DIRECTORY != 0 { - dir = pathname - } else { - dir, _ = filepath.Split(pathname) - dir = filepath.Clean(dir) - } - return -} - -func getIno(path string) (ino *inode, err error) { - h, e := syscall.CreateFile(syscall.StringToUTF16Ptr(path), - syscall.FILE_LIST_DIRECTORY, - syscall.FILE_SHARE_READ|syscall.FILE_SHARE_WRITE|syscall.FILE_SHARE_DELETE, - nil, syscall.OPEN_EXISTING, - syscall.FILE_FLAG_BACKUP_SEMANTICS|syscall.FILE_FLAG_OVERLAPPED, 0) - if e != nil { - return nil, os.NewSyscallError("CreateFile", e) - } - var fi syscall.ByHandleFileInformation - if e = syscall.GetFileInformationByHandle(h, &fi); e != nil { - syscall.CloseHandle(h) - return nil, os.NewSyscallError("GetFileInformationByHandle", e) - } - ino = &inode{ - handle: h, - volume: fi.VolumeSerialNumber, - index: uint64(fi.FileIndexHigh)<<32 | uint64(fi.FileIndexLow), - } - return ino, nil -} - -// Must run within the I/O thread. -func (m watchMap) get(ino *inode) *watch { - if i := m[ino.volume]; i != nil { - return i[ino.index] - } - return nil -} - -// Must run within the I/O thread. -func (m watchMap) set(ino *inode, watch *watch) { - i := m[ino.volume] - if i == nil { - i = make(indexMap) - m[ino.volume] = i - } - i[ino.index] = watch -} - -// Must run within the I/O thread. -func (w *Watcher) addWatch(pathname string, flags uint64) error { - dir, err := getDir(pathname) - if err != nil { - return err - } - if flags&sysFSONLYDIR != 0 && pathname != dir { - return nil - } - ino, err := getIno(dir) - if err != nil { - return err - } - w.mu.Lock() - watchEntry := w.watches.get(ino) - w.mu.Unlock() - if watchEntry == nil { - if _, e := syscall.CreateIoCompletionPort(ino.handle, w.port, 0, 0); e != nil { - syscall.CloseHandle(ino.handle) - return os.NewSyscallError("CreateIoCompletionPort", e) - } - watchEntry = &watch{ - ino: ino, - path: dir, - names: make(map[string]uint64), - } - w.mu.Lock() - w.watches.set(ino, watchEntry) - w.mu.Unlock() - flags |= provisional - } else { - syscall.CloseHandle(ino.handle) - } - if pathname == dir { - watchEntry.mask |= flags - } else { - watchEntry.names[filepath.Base(pathname)] |= flags - } - if err = w.startRead(watchEntry); err != nil { - return err - } - if pathname == dir { - watchEntry.mask &= ^provisional - } else { - watchEntry.names[filepath.Base(pathname)] &= ^provisional - } - return nil -} - -// Must run within the I/O thread. -func (w *Watcher) remWatch(pathname string) error { - dir, err := getDir(pathname) - if err != nil { - return err - } - ino, err := getIno(dir) - if err != nil { - return err - } - w.mu.Lock() - watch := w.watches.get(ino) - w.mu.Unlock() - if watch == nil { - return fmt.Errorf("can't remove non-existent watch for: %s", pathname) - } - if pathname == dir { - w.sendEvent(watch.path, watch.mask&sysFSIGNORED) - watch.mask = 0 - } else { - name := filepath.Base(pathname) - w.sendEvent(filepath.Join(watch.path, name), watch.names[name]&sysFSIGNORED) - delete(watch.names, name) - } - return w.startRead(watch) -} - -// Must run within the I/O thread. -func (w *Watcher) deleteWatch(watch *watch) { - for name, mask := range watch.names { - if mask&provisional == 0 { - w.sendEvent(filepath.Join(watch.path, name), mask&sysFSIGNORED) - } - delete(watch.names, name) - } - if watch.mask != 0 { - if watch.mask&provisional == 0 { - w.sendEvent(watch.path, watch.mask&sysFSIGNORED) - } - watch.mask = 0 - } -} - -// Must run within the I/O thread. -func (w *Watcher) startRead(watch *watch) error { - if e := syscall.CancelIo(watch.ino.handle); e != nil { - w.Errors <- os.NewSyscallError("CancelIo", e) - w.deleteWatch(watch) - } - mask := toWindowsFlags(watch.mask) - for _, m := range watch.names { - mask |= toWindowsFlags(m) - } - if mask == 0 { - if e := syscall.CloseHandle(watch.ino.handle); e != nil { - w.Errors <- os.NewSyscallError("CloseHandle", e) - } - w.mu.Lock() - delete(w.watches[watch.ino.volume], watch.ino.index) - w.mu.Unlock() - return nil - } - e := syscall.ReadDirectoryChanges(watch.ino.handle, &watch.buf[0], - uint32(unsafe.Sizeof(watch.buf)), false, mask, nil, &watch.ov, 0) - if e != nil { - err := os.NewSyscallError("ReadDirectoryChanges", e) - if e == syscall.ERROR_ACCESS_DENIED && watch.mask&provisional == 0 { - // Watched directory was probably removed - if w.sendEvent(watch.path, watch.mask&sysFSDELETESELF) { - if watch.mask&sysFSONESHOT != 0 { - watch.mask = 0 - } - } - err = nil - } - w.deleteWatch(watch) - w.startRead(watch) - return err - } - return nil -} - -// readEvents reads from the I/O completion port, converts the -// received events into Event objects and sends them via the Events channel. -// Entry point to the I/O thread. -func (w *Watcher) readEvents() { - var ( - n, key uint32 - ov *syscall.Overlapped - ) - runtime.LockOSThread() - - for { - e := syscall.GetQueuedCompletionStatus(w.port, &n, &key, &ov, syscall.INFINITE) - watch := (*watch)(unsafe.Pointer(ov)) - - if watch == nil { - select { - case ch := <-w.quit: - w.mu.Lock() - var indexes []indexMap - for _, index := range w.watches { - indexes = append(indexes, index) - } - w.mu.Unlock() - for _, index := range indexes { - for _, watch := range index { - w.deleteWatch(watch) - w.startRead(watch) - } - } - var err error - if e := syscall.CloseHandle(w.port); e != nil { - err = os.NewSyscallError("CloseHandle", e) - } - close(w.Events) - close(w.Errors) - ch <- err - return - case in := <-w.input: - switch in.op { - case opAddWatch: - in.reply <- w.addWatch(in.path, uint64(in.flags)) - case opRemoveWatch: - in.reply <- w.remWatch(in.path) - } - default: - } - continue - } - - switch e { - case syscall.ERROR_MORE_DATA: - if watch == nil { - w.Errors <- errors.New("ERROR_MORE_DATA has unexpectedly null lpOverlapped buffer") - } else { - // The i/o succeeded but the buffer is full. - // In theory we should be building up a full packet. - // In practice we can get away with just carrying on. - n = uint32(unsafe.Sizeof(watch.buf)) - } - case syscall.ERROR_ACCESS_DENIED: - // Watched directory was probably removed - w.sendEvent(watch.path, watch.mask&sysFSDELETESELF) - w.deleteWatch(watch) - w.startRead(watch) - continue - case syscall.ERROR_OPERATION_ABORTED: - // CancelIo was called on this handle - continue - default: - w.Errors <- os.NewSyscallError("GetQueuedCompletionPort", e) - continue - case nil: - } - - var offset uint32 - for { - if n == 0 { - w.Events <- newEvent("", sysFSQOVERFLOW) - w.Errors <- errors.New("short read in readEvents()") - break - } - - // Point "raw" to the event in the buffer - raw := (*syscall.FileNotifyInformation)(unsafe.Pointer(&watch.buf[offset])) - buf := (*[syscall.MAX_PATH]uint16)(unsafe.Pointer(&raw.FileName)) - name := syscall.UTF16ToString(buf[:raw.FileNameLength/2]) - fullname := filepath.Join(watch.path, name) - - var mask uint64 - switch raw.Action { - case syscall.FILE_ACTION_REMOVED: - mask = sysFSDELETESELF - case syscall.FILE_ACTION_MODIFIED: - mask = sysFSMODIFY - case syscall.FILE_ACTION_RENAMED_OLD_NAME: - watch.rename = name - case syscall.FILE_ACTION_RENAMED_NEW_NAME: - if watch.names[watch.rename] != 0 { - watch.names[name] |= watch.names[watch.rename] - delete(watch.names, watch.rename) - mask = sysFSMOVESELF - } - } - - sendNameEvent := func() { - if w.sendEvent(fullname, watch.names[name]&mask) { - if watch.names[name]&sysFSONESHOT != 0 { - delete(watch.names, name) - } - } - } - if raw.Action != syscall.FILE_ACTION_RENAMED_NEW_NAME { - sendNameEvent() - } - if raw.Action == syscall.FILE_ACTION_REMOVED { - w.sendEvent(fullname, watch.names[name]&sysFSIGNORED) - delete(watch.names, name) - } - if w.sendEvent(fullname, watch.mask&toFSnotifyFlags(raw.Action)) { - if watch.mask&sysFSONESHOT != 0 { - watch.mask = 0 - } - } - if raw.Action == syscall.FILE_ACTION_RENAMED_NEW_NAME { - fullname = filepath.Join(watch.path, watch.rename) - sendNameEvent() - } - - // Move to the next event in the buffer - if raw.NextEntryOffset == 0 { - break - } - offset += raw.NextEntryOffset - - // Error! - if offset >= n { - w.Errors <- errors.New("Windows system assumed buffer larger than it is, events have likely been missed.") - break - } - } - - if err := w.startRead(watch); err != nil { - w.Errors <- err - } - } -} - -func (w *Watcher) sendEvent(name string, mask uint64) bool { - if mask == 0 { - return false - } - event := newEvent(name, uint32(mask)) - select { - case ch := <-w.quit: - w.quit <- ch - case w.Events <- event: - } - return true -} - -func toWindowsFlags(mask uint64) uint32 { - var m uint32 - if mask&sysFSACCESS != 0 { - m |= syscall.FILE_NOTIFY_CHANGE_LAST_ACCESS - } - if mask&sysFSMODIFY != 0 { - m |= syscall.FILE_NOTIFY_CHANGE_LAST_WRITE - } - if mask&sysFSATTRIB != 0 { - m |= syscall.FILE_NOTIFY_CHANGE_ATTRIBUTES - } - if mask&(sysFSMOVE|sysFSCREATE|sysFSDELETE) != 0 { - m |= syscall.FILE_NOTIFY_CHANGE_FILE_NAME | syscall.FILE_NOTIFY_CHANGE_DIR_NAME - } - return m -} - -func toFSnotifyFlags(action uint32) uint64 { - switch action { - case syscall.FILE_ACTION_ADDED: - return sysFSCREATE - case syscall.FILE_ACTION_REMOVED: - return sysFSDELETE - case syscall.FILE_ACTION_MODIFIED: - return sysFSMODIFY - case syscall.FILE_ACTION_RENAMED_OLD_NAME: - return sysFSMOVEDFROM - case syscall.FILE_ACTION_RENAMED_NEW_NAME: - return sysFSMOVEDTO - } - return 0 -} diff --git a/vendor/github.com/hashicorp/consul/api/acl.go b/vendor/github.com/hashicorp/consul/api/acl.go index 3e13ccc..48d2e66 100644 --- a/vendor/github.com/hashicorp/consul/api/acl.go +++ b/vendor/github.com/hashicorp/consul/api/acl.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -269,6 +272,13 @@ type ACLAuthMethod struct { Partition string `json:",omitempty"` } +type ACLTokenFilterOptions struct { + AuthMethod string `json:",omitempty"` + Policy string `json:",omitempty"` + Role string `json:",omitempty"` + ServiceName string `json:",omitempty"` +} + func (m *ACLAuthMethod) MarshalJSON() ([]byte, error) { type Alias ACLAuthMethod exported := &struct { @@ -892,6 +902,44 @@ func (a *ACL) TokenList(q *QueryOptions) ([]*ACLTokenListEntry, *QueryMeta, erro return entries, qm, nil } +// TokenListFiltered lists all tokens that match the given filter options. +// The listing does not contain any SecretIDs as those may only be retrieved by a call to TokenRead. +func (a *ACL) TokenListFiltered(t ACLTokenFilterOptions, q *QueryOptions) ([]*ACLTokenListEntry, *QueryMeta, error) { + r := a.c.newRequest("GET", "/v1/acl/tokens") + r.setQueryOptions(q) + + if t.AuthMethod != "" { + r.params.Set("authmethod", t.AuthMethod) + } + if t.Policy != "" { + r.params.Set("policy", t.Policy) + } + if t.Role != "" { + r.params.Set("role", t.Role) + } + if t.ServiceName != "" { + r.params.Set("servicename", t.ServiceName) + } + + rtt, resp, err := a.c.doRequest(r) + if err != nil { + return nil, nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, nil, err + } + qm := &QueryMeta{} + parseQueryMeta(resp, qm) + qm.RequestTime = rtt + + var entries []*ACLTokenListEntry + if err := decodeBody(resp, &entries); err != nil { + return nil, nil, err + } + return entries, qm, nil +} + // PolicyCreate will create a new policy. It is not allowed for the policy parameters // ID field to be set as this will be generated by Consul while processing the request. func (a *ACL) PolicyCreate(policy *ACLPolicy, q *WriteOptions) (*ACLPolicy, *WriteMeta, error) { diff --git a/vendor/github.com/hashicorp/consul/api/agent.go b/vendor/github.com/hashicorp/consul/api/agent.go index 7904e7b..6775edf 100644 --- a/vendor/github.com/hashicorp/consul/api/agent.go +++ b/vendor/github.com/hashicorp/consul/api/agent.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -104,7 +107,8 @@ type AgentService struct { Namespace string `json:",omitempty" bexpr:"-" hash:"ignore"` Partition string `json:",omitempty" bexpr:"-" hash:"ignore"` // Datacenter is only ever returned and is ignored if presented. - Datacenter string `json:",omitempty" bexpr:"-" hash:"ignore"` + Datacenter string `json:",omitempty" bexpr:"-" hash:"ignore"` + Locality *Locality `json:",omitempty" bexpr:"-" hash:"ignore"` } // AgentServiceChecksInfo returns information about a Service and its checks @@ -270,6 +274,8 @@ type MembersOpts struct { // Segment is the LAN segment to show members for. Setting this to the // AllSegments value above will show members in all segments. Segment string + + Filter string } // AgentServiceRegistration is used to register a new service @@ -291,6 +297,7 @@ type AgentServiceRegistration struct { Connect *AgentServiceConnect `json:",omitempty"` Namespace string `json:",omitempty" bexpr:"-" hash:"ignore"` Partition string `json:",omitempty" bexpr:"-" hash:"ignore"` + Locality *Locality `json:",omitempty" bexpr:"-" hash:"ignore"` } // ServiceRegisterOpts is used to pass extra options to the service register. @@ -338,6 +345,7 @@ type AgentServiceCheck struct { Method string `json:",omitempty"` Body string `json:",omitempty"` TCP string `json:",omitempty"` + TCPUseTLS bool `json:",omitempty"` UDP string `json:",omitempty"` Status string `json:",omitempty"` Notes string `json:",omitempty"` @@ -498,6 +506,24 @@ func (a *Agent) Host() (map[string]interface{}, error) { return out, nil } +// Version is used to retrieve information about the running Consul version and build. +func (a *Agent) Version() (map[string]interface{}, error) { + r := a.c.newRequest("GET", "/v1/agent/version") + _, resp, err := a.c.doRequest(r) + if err != nil { + return nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, err + } + var out map[string]interface{} + if err := decodeBody(resp, &out); err != nil { + return nil, err + } + return out, nil +} + // Metrics is used to query the agent we are speaking to for // its current internal metric data func (a *Agent) Metrics() (*MetricsInfo, error) { @@ -767,6 +793,10 @@ func (a *Agent) MembersOpts(opts MembersOpts) ([]*AgentMember, error) { r.params.Set("wan", "1") } + if opts.Filter != "" { + r.params.Set("filter", opts.Filter) + } + _, resp, err := a.c.doRequest(r) if err != nil { return nil, err @@ -1050,8 +1080,17 @@ func (a *Agent) ForceLeavePrune(node string) error { // ForceLeaveOpts is used to have the agent eject a failed node or remove it // completely from the list of members. +// +// DEPRECATED - Use ForceLeaveOptions instead. func (a *Agent) ForceLeaveOpts(node string, opts ForceLeaveOpts) error { + return a.ForceLeaveOptions(node, opts, nil) +} + +// ForceLeaveOptions is used to have the agent eject a failed node or remove it +// completely from the list of members. Allows usage of QueryOptions on-top of ForceLeaveOpts +func (a *Agent) ForceLeaveOptions(node string, opts ForceLeaveOpts, q *QueryOptions) error { r := a.c.newRequest("PUT", "/v1/agent/force-leave/"+node) + r.setQueryOptions(q) if opts.Prune { r.params.Set("prune", "1") } diff --git a/vendor/github.com/hashicorp/consul/api/api.go b/vendor/github.com/hashicorp/consul/api/api.go index 772f869..f62c0c5 100644 --- a/vendor/github.com/hashicorp/consul/api/api.go +++ b/vendor/github.com/hashicorp/consul/api/api.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -833,12 +836,21 @@ func (r *request) setQueryOptions(q *QueryOptions) { return } if q.Namespace != "" { + // For backwards-compatibility with existing tests, + // use the short-hand query param name "ns" + // rather than the alternative long-hand "namespace" r.params.Set("ns", q.Namespace) } if q.Partition != "" { + // For backwards-compatibility with existing tests, + // use the long-hand query param name "partition" + // rather than the alternative short-hand "ap" r.params.Set("partition", q.Partition) } if q.Datacenter != "" { + // For backwards-compatibility with existing tests, + // use the short-hand query param name "dc" + // rather than the alternative long-hand "datacenter" r.params.Set("dc", q.Datacenter) } if q.Peer != "" { @@ -946,12 +958,16 @@ func (r *request) setWriteOptions(q *WriteOptions) { if q == nil { return } + // For backwards-compatibility, continue to use the shorthand "ns" + // rather than "namespace" if q.Namespace != "" { r.params.Set("ns", q.Namespace) } if q.Partition != "" { r.params.Set("partition", q.Partition) } + // For backwards-compatibility, continue to use the shorthand "dc" + // rather than "datacenter" if q.Datacenter != "" { r.params.Set("dc", q.Datacenter) } @@ -984,6 +1000,19 @@ func (r *request) toHTTP() (*http.Request, error) { return nil, err } + // validate that socket communications that do not use the host, detect + // slashes in the host name and replace it with local host. + // this is required since go started validating req.host in 1.20.6 and 1.19.11. + // prior to that they would strip out the slashes for you. They removed that + // behavior and added more strict validation as part of a CVE. + // This issue is being tracked by the Go team: + // https://github.com/golang/go/issues/61431 + // If there is a resolution in this issue, we will remove this code. + // In the time being, this is the accepted workaround. + if strings.HasPrefix(r.url.Host, "/") { + r.url.Host = "localhost" + } + req.URL.Host = r.url.Host req.URL.Scheme = r.url.Scheme req.Host = r.url.Host diff --git a/vendor/github.com/hashicorp/consul/api/catalog.go b/vendor/github.com/hashicorp/consul/api/catalog.go index 84a2bdb..0040ca6 100644 --- a/vendor/github.com/hashicorp/consul/api/catalog.go +++ b/vendor/github.com/hashicorp/consul/api/catalog.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -19,8 +22,9 @@ type Node struct { Meta map[string]string CreateIndex uint64 ModifyIndex uint64 - Partition string `json:",omitempty"` - PeerName string `json:",omitempty"` + Partition string `json:",omitempty"` + PeerName string `json:",omitempty"` + Locality *Locality `json:",omitempty"` } type ServiceAddress struct { @@ -45,6 +49,7 @@ type CatalogService struct { ServiceWeights Weights ServiceEnableTagOverride bool ServiceProxy *AgentServiceConnectProxyConfig + ServiceLocality *Locality `json:",omitempty"` CreateIndex uint64 Checks HealthChecks ModifyIndex uint64 @@ -73,7 +78,8 @@ type CatalogRegistration struct { Check *AgentCheck Checks HealthChecks SkipNodeUpdate bool - Partition string `json:",omitempty"` + Partition string `json:",omitempty"` + Locality *Locality `json:",omitempty"` } type CatalogDeregistration struct { diff --git a/vendor/github.com/hashicorp/consul/api/config_entry.go b/vendor/github.com/hashicorp/consul/api/config_entry.go index 7160d7d..405e92e 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -23,6 +26,8 @@ const ( ServiceIntentions string = "service-intentions" MeshConfig string = "mesh" ExportedServices string = "exported-services" + SamenessGroup string = "sameness-group" + RateLimitIPConfig string = "control-plane-request-limit" ProxyConfigGlobal string = "global" MeshConfigMesh string = "mesh" @@ -30,11 +35,15 @@ const ( TCPRoute string = "tcp-route" InlineCertificate string = "inline-certificate" HTTPRoute string = "http-route" + JWTProvider string = "jwt-provider" ) const ( - BuiltinAWSLambdaExtension string = "builtin/aws/lambda" - BuiltinLuaExtension string = "builtin/lua" + BuiltinAWSLambdaExtension string = "builtin/aws/lambda" + BuiltinExtAuthzExtension string = "builtin/ext-authz" + BuiltinLuaExtension string = "builtin/lua" + BuiltinPropertyOverrideExtension string = "builtin/property-override" + BuiltinWasmExtension string = "builtin/wasm" // BuiltinValidateExtension should not be exposed directly or accepted as a valid configured // extension type, as it is only used indirectly via troubleshooting tools. It is included here // for common reference alongside other builtin extensions. @@ -106,6 +115,21 @@ type TransparentProxyConfig struct { DialedDirectly bool `json:",omitempty" alias:"dialed_directly"` } +type MutualTLSMode string + +const ( + // MutualTLSModeDefault represents no specific mode and should + // be used to indicate that a different layer of the configuration + // chain should take precedence. + MutualTLSModeDefault MutualTLSMode = "" + + // MutualTLSModeStrict requires mTLS for incoming traffic. + MutualTLSModeStrict MutualTLSMode = "strict" + + // MutualTLSModePermissive allows incoming non-mTLS traffic. + MutualTLSModePermissive MutualTLSMode = "permissive" +) + // ExposeConfig describes HTTP paths to expose through Envoy outside of Connect. // Users can expose individual paths and/or all HTTP/GRPC paths for checks. type ExposeConfig struct { @@ -119,9 +143,11 @@ type ExposeConfig struct { // EnvoyExtension has configuration for an extension that patches Envoy resources. type EnvoyExtension struct { - Name string - Required bool - Arguments map[string]interface{} `bexpr:"-"` + Name string + Required bool + Arguments map[string]interface{} `bexpr:"-"` + ConsulVersion string + EnvoyVersion string } type ExposePath struct { @@ -296,6 +322,7 @@ type ServiceConfigEntry struct { Protocol string `json:",omitempty"` Mode ProxyMode `json:",omitempty"` TransparentProxy *TransparentProxyConfig `json:",omitempty" alias:"transparent_proxy"` + MutualTLSMode MutualTLSMode `json:",omitempty" alias:"mutual_tls_mode"` MeshGateway MeshGatewayConfig `json:",omitempty" alias:"mesh_gateway"` Expose ExposeConfig `json:",omitempty"` ExternalSNI string `json:",omitempty" alias:"external_sni"` @@ -320,17 +347,20 @@ func (s *ServiceConfigEntry) GetCreateIndex() uint64 { return s.CreateIndex func (s *ServiceConfigEntry) GetModifyIndex() uint64 { return s.ModifyIndex } type ProxyConfigEntry struct { - Kind string - Name string - Partition string `json:",omitempty"` - Namespace string `json:",omitempty"` - Mode ProxyMode `json:",omitempty"` - TransparentProxy *TransparentProxyConfig `json:",omitempty" alias:"transparent_proxy"` - Config map[string]interface{} `json:",omitempty"` - MeshGateway MeshGatewayConfig `json:",omitempty" alias:"mesh_gateway"` - Expose ExposeConfig `json:",omitempty"` - AccessLogs *AccessLogsConfig `json:",omitempty" alias:"access_logs"` - EnvoyExtensions []EnvoyExtension `json:",omitempty" alias:"envoy_extensions"` + Kind string + Name string + Partition string `json:",omitempty"` + Namespace string `json:",omitempty"` + Mode ProxyMode `json:",omitempty"` + TransparentProxy *TransparentProxyConfig `json:",omitempty" alias:"transparent_proxy"` + MutualTLSMode MutualTLSMode `json:",omitempty" alias:"mutual_tls_mode"` + Config map[string]interface{} `json:",omitempty"` + MeshGateway MeshGatewayConfig `json:",omitempty" alias:"mesh_gateway"` + Expose ExposeConfig `json:",omitempty"` + AccessLogs *AccessLogsConfig `json:",omitempty" alias:"access_logs"` + EnvoyExtensions []EnvoyExtension `json:",omitempty" alias:"envoy_extensions"` + FailoverPolicy *ServiceResolverFailoverPolicy `json:",omitempty" alias:"failover_policy"` + PrioritizeByLocality *ServiceResolverPrioritizeByLocality `json:",omitempty" alias:"prioritize_by_locality"` Meta map[string]string `json:",omitempty"` CreateIndex uint64 @@ -367,6 +397,8 @@ func makeConfigEntry(kind, name string) (ConfigEntry, error) { return &MeshConfigEntry{}, nil case ExportedServices: return &ExportedServicesConfigEntry{Name: name}, nil + case SamenessGroup: + return &SamenessGroupConfigEntry{Kind: kind, Name: name}, nil case APIGateway: return &APIGatewayConfigEntry{Kind: kind, Name: name}, nil case TCPRoute: @@ -375,6 +407,10 @@ func makeConfigEntry(kind, name string) (ConfigEntry, error) { return &InlineCertificateConfigEntry{Kind: kind, Name: name}, nil case HTTPRoute: return &HTTPRouteConfigEntry{Kind: kind, Name: name}, nil + case RateLimitIPConfig: + return &RateLimitIPConfigEntry{Kind: kind, Name: name}, nil + case JWTProvider: + return &JWTProviderConfigEntry{Kind: kind, Name: name}, nil default: return nil, fmt.Errorf("invalid config entry kind: %s", kind) } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go b/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go index acc05e1..3696f7b 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -169,6 +172,10 @@ type ServiceResolverConfigEntry struct { ConnectTimeout time.Duration `json:",omitempty" alias:"connect_timeout"` RequestTimeout time.Duration `json:",omitempty" alias:"request_timeout"` + // PrioritizeByLocality controls whether the locality of services within the + // local partition will be used to prioritize connectivity. + PrioritizeByLocality *ServiceResolverPrioritizeByLocality `json:",omitempty" alias:"prioritize_by_locality"` + // LoadBalancer determines the load balancing policy and configuration for services // issuing requests to this upstream service. LoadBalancer *LoadBalancer `json:",omitempty" alias:"load_balancer"` @@ -234,15 +241,18 @@ type ServiceResolverRedirect struct { Partition string `json:",omitempty"` Datacenter string `json:",omitempty"` Peer string `json:",omitempty"` + SamenessGroup string `json:",omitempty" alias:"sameness_group"` } type ServiceResolverFailover struct { Service string `json:",omitempty"` ServiceSubset string `json:",omitempty" alias:"service_subset"` // Referencing other partitions is not supported. - Namespace string `json:",omitempty"` - Datacenters []string `json:",omitempty"` - Targets []ServiceResolverFailoverTarget `json:",omitempty"` + Namespace string `json:",omitempty"` + Datacenters []string `json:",omitempty"` + Targets []ServiceResolverFailoverTarget `json:",omitempty"` + Policy *ServiceResolverFailoverPolicy `json:",omitempty"` + SamenessGroup string `json:",omitempty" alias:"sameness_group"` } type ServiceResolverFailoverTarget struct { @@ -254,6 +264,20 @@ type ServiceResolverFailoverTarget struct { Peer string `json:",omitempty"` } +type ServiceResolverFailoverPolicy struct { + // Mode specifies the type of failover that will be performed. Valid values are + // "sequential", "" (equivalent to "sequential") and "order-by-locality". + Mode string `json:",omitempty"` + Regions []string `json:",omitempty"` +} + +type ServiceResolverPrioritizeByLocality struct { + // Mode specifies the type of prioritization that will be performed + // when selecting nodes in the local partition. + // Valid values are: "" (default "none"), "none", and "failover". + Mode string `json:",omitempty"` +} + // LoadBalancer determines the load balancing policy and configuration for services // issuing requests to this upstream service. type LoadBalancer struct { diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_exports.go b/vendor/github.com/hashicorp/consul/api/config_entry_exports.go index 52b0491..97920e4 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_exports.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_exports.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import "encoding/json" @@ -51,6 +54,9 @@ type ServiceConsumer struct { // Peer is the name of the peer to export the service to. Peer string `json:",omitempty" alias:"peer_name"` + + // SamenessGroup is the name of the sameness group to export the service to. + SamenessGroup string `json:",omitempty" alias:"sameness_group"` } func (e *ExportedServicesConfigEntry) GetKind() string { return ExportedServices } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go b/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go index 05e4383..b59f1c0 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // IngressGatewayConfigEntry manages the configuration for an ingress service diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go b/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go index bbf12cc..47a1ead 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // InlineCertificateConfigEntry -- TODO stub diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go b/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go index 0bff5e8..3f03b08 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import "time" @@ -9,6 +12,7 @@ type ServiceIntentionsConfigEntry struct { Namespace string `json:",omitempty"` Sources []*SourceIntention + JWT *IntentionJWTRequirement `json:",omitempty"` Meta map[string]string `json:",omitempty"` @@ -17,15 +21,16 @@ type ServiceIntentionsConfigEntry struct { } type SourceIntention struct { - Name string - Peer string `json:",omitempty"` - Partition string `json:",omitempty"` - Namespace string `json:",omitempty"` - Action IntentionAction `json:",omitempty"` - Permissions []*IntentionPermission `json:",omitempty"` - Precedence int - Type IntentionSourceType - Description string `json:",omitempty"` + Name string + Peer string `json:",omitempty"` + Partition string `json:",omitempty"` + Namespace string `json:",omitempty"` + SamenessGroup string `json:",omitempty" alias:"sameness_group"` + Action IntentionAction `json:",omitempty"` + Permissions []*IntentionPermission `json:",omitempty"` + Precedence int + Type IntentionSourceType + Description string `json:",omitempty"` LegacyID string `json:",omitempty" alias:"legacy_id"` LegacyMeta map[string]string `json:",omitempty" alias:"legacy_meta"` @@ -44,6 +49,7 @@ func (e *ServiceIntentionsConfigEntry) GetModifyIndex() uint64 { return e.Mo type IntentionPermission struct { Action IntentionAction HTTP *IntentionHTTPPermission `json:",omitempty"` + JWT *IntentionJWTRequirement `json:",omitempty"` } type IntentionHTTPPermission struct { @@ -65,3 +71,30 @@ type IntentionHTTPHeaderPermission struct { Regex string `json:",omitempty"` Invert bool `json:",omitempty"` } + +type IntentionJWTRequirement struct { + // Providers is a list of providers to consider when verifying a JWT. + Providers []*IntentionJWTProvider `json:",omitempty"` +} + +type IntentionJWTProvider struct { + // Name is the name of the JWT provider. There MUST be a corresponding + // "jwt-provider" config entry with this name. + Name string `json:",omitempty"` + + // VerifyClaims is a list of additional claims to verify in a JWT's payload. + VerifyClaims []*IntentionJWTClaimVerification `json:",omitempty" alias:"verify_claims"` +} + +type IntentionJWTClaimVerification struct { + // Path is the path to the claim in the token JSON. + Path []string `json:",omitempty"` + + // Value is the expected value at the given path: + // - If the type at the path is a list then we verify + // that this value is contained in the list. + // + // - If the type at the path is a string then we verify + // that this value matches. + Value string `json:",omitempty"` +} diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go b/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go new file mode 100644 index 0000000..270f0d5 --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go @@ -0,0 +1,310 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +package api + +import ( + "time" +) + +const ( + DiscoveryTypeStrictDNS ClusterDiscoveryType = "STRICT_DNS" + DiscoveryTypeStatic ClusterDiscoveryType = "STATIC" + DiscoveryTypeLogicalDNS ClusterDiscoveryType = "LOGICAL_DNS" + DiscoveryTypeEDS ClusterDiscoveryType = "EDS" + DiscoveryTypeOriginalDST ClusterDiscoveryType = "ORIGINAL_DST" +) + +type JWTProviderConfigEntry struct { + // Kind is the kind of configuration entry and must be "jwt-provider". + Kind string `json:",omitempty"` + + // Name is the name of the provider being configured. + Name string `json:",omitempty"` + + // JSONWebKeySet defines a JSON Web Key Set, its location on disk, or the + // means with which to fetch a key set from a remote server. + JSONWebKeySet *JSONWebKeySet `json:",omitempty" alias:"json_web_key_set"` + + // Issuer is the entity that must have issued the JWT. + // This value must match the "iss" claim of the token. + Issuer string `json:",omitempty"` + + // Audiences is the set of audiences the JWT is allowed to access. + // If specified, all JWTs verified with this provider must address + // at least one of these to be considered valid. + Audiences []string `json:",omitempty"` + + // Locations where the JWT will be present in requests. + // Envoy will check all of these locations to extract a JWT. + // If no locations are specified Envoy will default to: + // 1. Authorization header with Bearer schema: + // "Authorization: Bearer " + // 2. access_token query parameter. + Locations []*JWTLocation `json:",omitempty"` + + // Forwarding defines rules for forwarding verified JWTs to the backend. + Forwarding *JWTForwardingConfig `json:",omitempty"` + + // ClockSkewSeconds specifies the maximum allowable time difference + // from clock skew when validating the "exp" (Expiration) and "nbf" + // (Not Before) claims. + // + // Default value is 30 seconds. + ClockSkewSeconds int `json:",omitempty" alias:"clock_skew_seconds"` + + // CacheConfig defines configuration for caching the validation + // result for previously seen JWTs. Caching results can speed up + // verification when individual tokens are expected to be handled + // multiple times. + CacheConfig *JWTCacheConfig `json:",omitempty" alias:"cache_config"` + + Meta map[string]string `json:",omitempty"` + + // CreateIndex is the Raft index this entry was created at. This is a + // read-only field. + CreateIndex uint64 `json:",omitempty"` + + // ModifyIndex is used for the Check-And-Set operations and can also be fed + // back into the WaitIndex of the QueryOptions in order to perform blocking + // queries. + ModifyIndex uint64 `json:",omitempty"` + + // Partition is the partition the JWTProviderConfigEntry applies to. + // Partitioning is a Consul Enterprise feature. + Partition string `json:",omitempty"` + + // Namespace is the namespace the JWTProviderConfigEntry applies to. + // Namespacing is a Consul Enterprise feature. + Namespace string `json:",omitempty"` +} + +// JWTLocation is a location where the JWT could be present in requests. +// +// Only one of Header, QueryParam, or Cookie can be specified. +type JWTLocation struct { + // Header defines how to extract a JWT from an HTTP request header. + Header *JWTLocationHeader `json:",omitempty"` + + // QueryParam defines how to extract a JWT from an HTTP request + // query parameter. + QueryParam *JWTLocationQueryParam `json:",omitempty" alias:"query_param"` + + // Cookie defines how to extract a JWT from an HTTP request cookie. + Cookie *JWTLocationCookie `json:",omitempty"` +} + +// JWTLocationHeader defines how to extract a JWT from an HTTP +// request header. +type JWTLocationHeader struct { + // Name is the name of the header containing the token. + Name string `json:",omitempty"` + + // ValuePrefix is an optional prefix that precedes the token in the + // header value. + // For example, "Bearer " is a standard value prefix for a header named + // "Authorization", but the prefix is not part of the token itself: + // "Authorization: Bearer " + ValuePrefix string `json:",omitempty" alias:"value_prefix"` + + // Forward defines whether the header with the JWT should be + // forwarded after the token has been verified. If false, the + // header will not be forwarded to the backend. + // + // Default value is false. + Forward bool `json:",omitempty"` +} + +// JWTLocationQueryParam defines how to extract a JWT from an HTTP request query parameter. +type JWTLocationQueryParam struct { + // Name is the name of the query param containing the token. + Name string `json:",omitempty"` +} + +// JWTLocationCookie defines how to extract a JWT from an HTTP request cookie. +type JWTLocationCookie struct { + // Name is the name of the cookie containing the token. + Name string `json:",omitempty"` +} + +type JWTForwardingConfig struct { + // HeaderName is a header name to use when forwarding a verified + // JWT to the backend. The verified JWT could have been extracted + // from any location (query param, header, or cookie). + // + // The header value will be base64-URL-encoded, and will not be + // padded unless PadForwardPayloadHeader is true. + HeaderName string `json:",omitempty" alias:"header_name"` + + // PadForwardPayloadHeader determines whether padding should be added + // to the base64 encoded token forwarded with ForwardPayloadHeader. + // + // Default value is false. + PadForwardPayloadHeader bool `json:",omitempty" alias:"pad_forward_payload_header"` +} + +// JSONWebKeySet defines a key set, its location on disk, or the +// means with which to fetch a key set from a remote server. +// +// Exactly one of Local or Remote must be specified. +type JSONWebKeySet struct { + // Local specifies a local source for the key set. + Local *LocalJWKS `json:",omitempty"` + + // Remote specifies how to fetch a key set from a remote server. + Remote *RemoteJWKS `json:",omitempty"` +} + +// LocalJWKS specifies a location for a local JWKS. +// +// Only one of String and Filename can be specified. +type LocalJWKS struct { + // JWKS contains a base64 encoded JWKS. + JWKS string `json:",omitempty"` + + // Filename configures a location on disk where the JWKS can be + // found. If specified, the file must be present on the disk of ALL + // proxies with intentions referencing this provider. + Filename string `json:",omitempty"` +} + +// RemoteJWKS specifies how to fetch a JWKS from a remote server. +type RemoteJWKS struct { + // URI is the URI of the server to query for the JWKS. + URI string `json:",omitempty"` + + // RequestTimeoutMs is the number of milliseconds to + // time out when making a request for the JWKS. + RequestTimeoutMs int `json:",omitempty" alias:"request_timeout_ms"` + + // CacheDuration is the duration after which cached keys + // should be expired. + // + // Default value is 5 minutes. + CacheDuration time.Duration `json:",omitempty" alias:"cache_duration"` + + // FetchAsynchronously indicates that the JWKS should be fetched + // when a client request arrives. Client requests will be paused + // until the JWKS is fetched. + // If false, the proxy listener will wait for the JWKS to be + // fetched before being activated. + // + // Default value is false. + FetchAsynchronously bool `json:",omitempty" alias:"fetch_asynchronously"` + + // RetryPolicy defines a retry policy for fetching JWKS. + // + // There is no retry by default. + RetryPolicy *JWKSRetryPolicy `json:",omitempty" alias:"retry_policy"` + + // JWKSCluster defines how the specified Remote JWKS URI is to be fetched. + JWKSCluster *JWKSCluster `json:",omitempty" alias:"jwks_cluster"` +} + +type JWKSCluster struct { + // DiscoveryType refers to the service discovery type to use for resolving the cluster. + // + // This defaults to STRICT_DNS. + // Other options include STATIC, LOGICAL_DNS, EDS or ORIGINAL_DST. + DiscoveryType ClusterDiscoveryType `json:",omitempty" alias:"discovery_type"` + + // TLSCertificates refers to the data containing certificate authority certificates to use + // in verifying a presented peer certificate. + // If not specified and a peer certificate is presented it will not be verified. + // + // Must be either CaCertificateProviderInstance or TrustedCA. + TLSCertificates *JWKSTLSCertificate `json:",omitempty" alias:"tls_certificates"` + + // The timeout for new network connections to hosts in the cluster. + // If not set, a default value of 5s will be used. + ConnectTimeout time.Duration `json:",omitempty" alias:"connect_timeout"` +} + +type ClusterDiscoveryType string + +// JWKSTLSCertificate refers to the data containing certificate authority certificates to use +// in verifying a presented peer certificate. +// If not specified and a peer certificate is presented it will not be verified. +// +// Must be either CaCertificateProviderInstance or TrustedCA. +type JWKSTLSCertificate struct { + // CaCertificateProviderInstance Certificate provider instance for fetching TLS certificates. + CaCertificateProviderInstance *JWKSTLSCertProviderInstance `json:",omitempty" alias:"ca_certificate_provider_instance"` + + // TrustedCA defines TLS certificate data containing certificate authority certificates + // to use in verifying a presented peer certificate. + // + // Exactly one of Filename, EnvironmentVariable, InlineString or InlineBytes must be specified. + TrustedCA *JWKSTLSCertTrustedCA `json:",omitempty" alias:"trusted_ca"` +} + +// JWKSTLSCertTrustedCA defines TLS certificate data containing certificate authority certificates +// to use in verifying a presented peer certificate. +// +// Exactly one of Filename, EnvironmentVariable, InlineString or InlineBytes must be specified. +type JWKSTLSCertTrustedCA struct { + Filename string `json:",omitempty" alias:"filename"` + EnvironmentVariable string `json:",omitempty" alias:"environment_variable"` + InlineString string `json:",omitempty" alias:"inline_string"` + InlineBytes []byte `json:",omitempty" alias:"inline_bytes"` +} + +type JWKSTLSCertProviderInstance struct { + // InstanceName refers to the certificate provider instance name + // + // The default value is "default". + InstanceName string `json:",omitempty" alias:"instance_name"` + + // CertificateName is used to specify certificate instances or types. For example, "ROOTCA" to specify + // a root-certificate (validation context) or "example.com" to specify a certificate for a + // particular domain. + // + // The default value is the empty string. + CertificateName string `json:",omitempty" alias:"certificate_name"` +} + +type JWKSRetryPolicy struct { + // NumRetries is the number of times to retry fetching the JWKS. + // The retry strategy uses jittered exponential backoff with + // a base interval of 1s and max of 10s. + // + // Default value is 0. + NumRetries int `json:",omitempty" alias:"num_retries"` + + // Backoff policy + // + // Defaults to Envoy's backoff policy + RetryPolicyBackOff *RetryPolicyBackOff `json:",omitempty" alias:"retry_policy_back_off"` +} + +type RetryPolicyBackOff struct { + // BaseInterval to be used for the next back off computation + // + // The default value from envoy is 1s + BaseInterval time.Duration `json:",omitempty" alias:"base_interval"` + + // MaxInternal to be used to specify the maximum interval between retries. + // Optional but should be greater or equal to BaseInterval. + // + // Defaults to 10 times BaseInterval + MaxInterval time.Duration `json:",omitempty" alias:"max_interval"` +} + +type JWTCacheConfig struct { + // Size specifies the maximum number of JWT verification + // results to cache. + // + // Defaults to 0, meaning that JWT caching is disabled. + Size int `json:",omitempty"` +} + +func (e *JWTProviderConfigEntry) GetKind() string { + return JWTProvider +} + +func (e *JWTProviderConfigEntry) GetName() string { return e.Name } +func (e *JWTProviderConfigEntry) GetMeta() map[string]string { return e.Meta } +func (e *JWTProviderConfigEntry) GetCreateIndex() uint64 { return e.CreateIndex } +func (e *JWTProviderConfigEntry) GetModifyIndex() uint64 { return e.ModifyIndex } +func (e *JWTProviderConfigEntry) GetPartition() string { return e.Partition } +func (e *JWTProviderConfigEntry) GetNamespace() string { return e.Namespace } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go b/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go index 98b8822..1a1ebb8 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -19,6 +22,10 @@ type MeshConfigEntry struct { // in transparent mode. TransparentProxy TransparentProxyMeshConfig `alias:"transparent_proxy"` + // AllowEnablingPermissiveMutualTLS must be true in order to allow setting + // MutualTLSMode=permissive in either service-defaults or proxy-defaults. + AllowEnablingPermissiveMutualTLS bool `json:",omitempty" alias:"allow_enabling_permissive_mutual_tls"` + TLS *MeshTLSConfig `json:",omitempty"` HTTP *MeshHTTPConfig `json:",omitempty"` diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_rate_limit_ip.go b/vendor/github.com/hashicorp/consul/api/config_entry_rate_limit_ip.go new file mode 100644 index 0000000..8df7d4c --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/config_entry_rate_limit_ip.go @@ -0,0 +1,91 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +package api + +type ReadWriteRatesConfig struct { + ReadRate float64 + WriteRate float64 +} + +type RateLimitIPConfigEntry struct { + // Kind of the config entry. This will be set to structs.RateLimitIPConfig + Kind string + Name string + Mode string // {permissive, enforcing, disabled} + + Meta map[string]string `json:",omitempty"` + // overall limits + ReadRate float64 + WriteRate float64 + + //limits specific to a type of call + ACL *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryACL OperationCategory = "ACL" + Catalog *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryCatalog OperationCategory = "Catalog" + ConfigEntry *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryConfigEntry OperationCategory = "ConfigEntry" + ConnectCA *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryConnectCA OperationCategory = "ConnectCA" + Coordinate *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryCoordinate OperationCategory = "Coordinate" + DiscoveryChain *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryDiscoveryChain OperationCategory = "DiscoveryChain" + ServerDiscovery *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryServerDiscovery OperationCategory = "ServerDiscovery" + Health *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryHealth OperationCategory = "Health" + Intention *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryIntention OperationCategory = "Intention" + KV *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryKV OperationCategory = "KV" + Tenancy *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPartition OperationCategory = "Tenancy" + PreparedQuery *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPreparedQuery OperationCategory = "PreparedQuery" + Session *ReadWriteRatesConfig `json:",omitempty"` // OperationCategorySession OperationCategory = "Session" + Txn *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryTxn OperationCategory = "Txn" + AutoConfig *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryAutoConfig OperationCategory = "AutoConfig" + FederationState *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryFederationState OperationCategory = "FederationState" + Internal *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryInternal OperationCategory = "Internal" + PeerStream *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPeerStream OperationCategory = "PeerStream" + Peering *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPeering OperationCategory = "Peering" + DataPlane *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryDataPlane OperationCategory = "DataPlane" + DNS *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryDNS OperationCategory = "DNS" + Subscribe *ReadWriteRatesConfig `json:",omitempty"` // OperationCategorySubscribe OperationCategory = "Subscribe" + Resource *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryResource OperationCategory = "Resource" + + // Partition is the partition the config entry is associated with. + // Partitioning is a Consul Enterprise feature. + Partition string `json:",omitempty"` + + // Namespace is the namespace the config entry is associated with. + // Namespacing is a Consul Enterprise feature. + Namespace string `json:",omitempty"` + + // CreateIndex is the Raft index this entry was created at. This is a + // read-only field. + CreateIndex uint64 + + // ModifyIndex is used for the Check-And-Set operations and can also be fed + // back into the WaitIndex of the QueryOptions in order to perform blocking + // queries. + ModifyIndex uint64 +} + +func (r *RateLimitIPConfigEntry) GetKind() string { + return RateLimitIPConfig +} +func (r *RateLimitIPConfigEntry) GetName() string { + if r == nil { + return "" + } + return r.Name +} +func (r *RateLimitIPConfigEntry) GetPartition() string { + return r.Partition +} +func (r *RateLimitIPConfigEntry) GetNamespace() string { + return r.Namespace +} +func (r *RateLimitIPConfigEntry) GetMeta() map[string]string { + if r == nil { + return nil + } + return r.Meta +} +func (r *RateLimitIPConfigEntry) GetCreateIndex() uint64 { + return r.CreateIndex +} +func (r *RateLimitIPConfigEntry) GetModifyIndex() uint64 { + return r.ModifyIndex +} diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_routes.go b/vendor/github.com/hashicorp/consul/api/config_entry_routes.go index 2edf9b2..cfea394 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_routes.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_routes.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // TCPRouteConfigEntry -- TODO stub diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_sameness_group.go b/vendor/github.com/hashicorp/consul/api/config_entry_sameness_group.go new file mode 100644 index 0000000..1217efe --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/config_entry_sameness_group.go @@ -0,0 +1,29 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +package api + +type SamenessGroupConfigEntry struct { + Kind string + Name string + Partition string `json:",omitempty"` + DefaultForFailover bool `json:",omitempty" alias:"default_for_failover"` + IncludeLocal bool `json:",omitempty" alias:"include_local"` + Members []SamenessGroupMember + Meta map[string]string `json:",omitempty"` + CreateIndex uint64 + ModifyIndex uint64 +} + +type SamenessGroupMember struct { + Partition string `json:",omitempty"` + Peer string `json:",omitempty"` +} + +func (s *SamenessGroupConfigEntry) GetKind() string { return s.Kind } +func (s *SamenessGroupConfigEntry) GetName() string { return s.Name } +func (s *SamenessGroupConfigEntry) GetPartition() string { return s.Partition } +func (s *SamenessGroupConfigEntry) GetNamespace() string { return "" } +func (s *SamenessGroupConfigEntry) GetCreateIndex() uint64 { return s.CreateIndex } +func (s *SamenessGroupConfigEntry) GetModifyIndex() uint64 { return s.ModifyIndex } +func (s *SamenessGroupConfigEntry) GetMeta() map[string]string { return s.Meta } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_status.go b/vendor/github.com/hashicorp/consul/api/config_entry_status.go index 8352364..2d16ea0 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_status.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_status.go @@ -1,7 +1,13 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( + "fmt" "time" + + "golang.org/x/exp/slices" ) // ResourceReference is a reference to a ConfigEntry @@ -43,7 +49,7 @@ type Condition struct { // Type is a value from a bounded set of types that an object might have Type string // Status is a value from a bounded set of statuses that an object might have - Status string + Status ConditionStatus // Reason is a value from a bounded set of reasons for a given status Reason string // Message is a message that gives more detailed information about @@ -55,3 +61,279 @@ type Condition struct { // LastTransitionTime is the time at which this Condition was created LastTransitionTime *time.Time } + +type ( + ConditionStatus string +) + +const ( + ConditionStatusTrue ConditionStatus = "True" + ConditionStatusFalse ConditionStatus = "False" + ConditionStatusUnknown ConditionStatus = "Unknown" +) + +// GatewayConditionType is a type of condition associated with a +// Gateway. This type should be used with the GatewayStatus.Conditions +// field. +type GatewayConditionType string + +// GatewayConditionReason defines the set of reasons that explain why a +// particular Gateway condition type has been raised. +type GatewayConditionReason string + +// the following are directly from the k8s spec +const ( + // This condition is true when the controller managing the Gateway is + // syntactically and semantically valid enough to produce some configuration + // in the underlying data plane. This does not indicate whether or not the + // configuration has been propagated to the data plane. + // + // Possible reasons for this condition to be True are: + // + // * "Accepted" + // + // Possible reasons for this condition to be False are: + // + // * InvalidCertificates + // + GatewayConditionAccepted GatewayConditionType = "Accepted" + + // This reason is used with the "Accepted" condition when the condition is + // True. + GatewayReasonAccepted GatewayConditionReason = "Accepted" + + // This reason is used with the "Accepted" condition when the gateway has multiple invalid + // certificates and cannot bind to any routes + GatewayReasonInvalidCertificates GatewayConditionReason = "InvalidCertificates" + + // This condition indicates that the gateway was unable to resolve + // conflicting specification requirements for this Listener. If a + // Listener is conflicted, its network port should not be configured + // on any network elements. + // + // Possible reasons for this condition to be true are: + // + // * "RouteConflict" + // + // Possible reasons for this condition to be False are: + // + // * "NoConflict" + // + // Controllers may raise this condition with other reasons, + // but should prefer to use the reasons listed above to improve + // interoperability. + GatewayConditionConflicted GatewayConditionType = "Conflicted" + // This reason is used with the "Conflicted" condition when the condition + // is False. + GatewayReasonNoConflict GatewayConditionReason = "NoConflict" + // This reason is used with the "Conflicted" condition when the route is + // in a conflicted state, such as when a TCPListener attempts to bind to two routes + GatewayReasonRouteConflict GatewayConditionReason = "RouteConflict" + + // This condition indicates whether the controller was able to + // resolve all the object references for the Gateway. When setting this + // condition to False, a ResourceReference to the misconfigured Listener should + // be provided. + // + // Possible reasons for this condition to be true are: + // + // * "ResolvedRefs" + // + // Possible reasons for this condition to be False are: + // + // * "InvalidCertificateRef" + // * "InvalidRouteKinds" + // * "RefNotPermitted" + // + GatewayConditionResolvedRefs GatewayConditionType = "ResolvedRefs" + + // This reason is used with the "ResolvedRefs" condition when the condition + // is true. + GatewayReasonResolvedRefs GatewayConditionReason = "ResolvedRefs" + + // This reason is used with the "ResolvedRefs" condition when a + // Listener has a TLS configuration with at least one TLS CertificateRef + // that is invalid or does not exist. + // A CertificateRef is considered invalid when it refers to a nonexistent + // or unsupported resource or kind, or when the data within that resource + // is malformed. + // This reason must be used only when the reference is allowed, either by + // referencing an object in the same namespace as the Gateway, or when + // a cross-namespace reference has been explicitly allowed by a ReferenceGrant. + // If the reference is not allowed, the reason RefNotPermitted must be used + // instead. + GatewayListenerReasonInvalidCertificateRef GatewayConditionReason = "InvalidCertificateRef" +) + +var validGatewayConditionReasonsMapping = map[GatewayConditionType]map[ConditionStatus][]GatewayConditionReason{ + GatewayConditionAccepted: { + ConditionStatusTrue: { + GatewayReasonAccepted, + }, + ConditionStatusFalse: { + GatewayReasonInvalidCertificates, + }, + ConditionStatusUnknown: {}, + }, + GatewayConditionConflicted: { + ConditionStatusTrue: { + GatewayReasonRouteConflict, + }, + ConditionStatusFalse: { + GatewayReasonNoConflict, + }, + ConditionStatusUnknown: {}, + }, + GatewayConditionResolvedRefs: { + ConditionStatusTrue: { + GatewayReasonResolvedRefs, + }, + ConditionStatusFalse: { + GatewayListenerReasonInvalidCertificateRef, + }, + ConditionStatusUnknown: {}, + }, +} + +func ValidateGatewayConditionReason(name GatewayConditionType, status ConditionStatus, reason GatewayConditionReason) error { + if err := checkConditionStatus(status); err != nil { + return err + } + + reasons, ok := validGatewayConditionReasonsMapping[name] + if !ok { + return fmt.Errorf("unrecognized GatewayConditionType %q", name) + } + + reasonsForStatus, ok := reasons[status] + if !ok { + return fmt.Errorf("unrecognized ConditionStatus %q", status) + } + + if !slices.Contains(reasonsForStatus, reason) { + return fmt.Errorf("gateway condition reason %q not allowed for gateway condition type %q with status %q", reason, name, status) + } + return nil +} + +// RouteConditionType is a type of condition for a route. +type RouteConditionType string + +// RouteConditionReason is a reason for a route condition. +type RouteConditionReason string + +// The following statuses are taken from the K8's Spec +// With the exception of: "RouteReasonInvalidDiscoveryChain" and "NoUpstreamServicesTargeted" +const ( + // This condition indicates whether the route has been accepted or rejected + // by a Gateway, and why. + // + // Possible reasons for this condition to be true are: + // + // * "Accepted" + // + // Possible reasons for this condition to be False are: + // + // * "InvalidDiscoveryChain" + // * "NoUpstreamServicesTargeted" + // + // + // Controllers may raise this condition with other reasons, + // but should prefer to use the reasons listed above to improve + // interoperability. + RouteConditionAccepted RouteConditionType = "Accepted" + + // This reason is used with the "Accepted" condition when the Route has been + // accepted by the Gateway. + RouteReasonAccepted RouteConditionReason = "Accepted" + + // This reason is used with the "Accepted" condition when the route has an + // invalid discovery chain, this includes conditions like the protocol being invalid + // or the discovery chain failing to compile + RouteReasonInvalidDiscoveryChain RouteConditionReason = "InvalidDiscoveryChain" + + // This reason is used with the "Accepted" condition when the route + RouteReasonNoUpstreamServicesTargeted RouteConditionReason = "NoUpstreamServicesTargeted" +) + +// the following statuses are custom to Consul +const ( + // This condition indicates whether the route was able to successfully bind the + // Listener on the gateway + // Possible reasons for this condition to be true are: + // + // * "Bound" + // + // Possible reasons for this condition to be false are: + // + // * "FailedToBind" + // * "GatewayNotFound" + // + RouteConditionBound RouteConditionType = "Bound" + + // This reason is used with the "Bound" condition when the condition + // is true + RouteReasonBound RouteConditionReason = "Bound" + + // This reason is used with the "Bound" condition when the route failed + // to bind to the gateway + RouteReasonFailedToBind RouteConditionReason = "FailedToBind" + + // This reason is used with the "Bound" condition when the route fails + // to find the gateway + RouteReasonGatewayNotFound RouteConditionReason = "GatewayNotFound" +) + +var validRouteConditionReasonsMapping = map[RouteConditionType]map[ConditionStatus][]RouteConditionReason{ + RouteConditionAccepted: { + ConditionStatusTrue: { + RouteReasonAccepted, + }, + ConditionStatusFalse: { + RouteReasonInvalidDiscoveryChain, + RouteReasonNoUpstreamServicesTargeted, + }, + ConditionStatusUnknown: {}, + }, + RouteConditionBound: { + ConditionStatusTrue: { + RouteReasonBound, + }, + ConditionStatusFalse: { + RouteReasonGatewayNotFound, + RouteReasonFailedToBind, + }, + ConditionStatusUnknown: {}, + }, +} + +func ValidateRouteConditionReason(name RouteConditionType, status ConditionStatus, reason RouteConditionReason) error { + if err := checkConditionStatus(status); err != nil { + return err + } + + reasons, ok := validRouteConditionReasonsMapping[name] + if !ok { + return fmt.Errorf("unrecognized RouteConditionType %s", name) + } + + reasonsForStatus, ok := reasons[status] + if !ok { + return fmt.Errorf("unrecognized ConditionStatus %s", name) + } + + if !slices.Contains(reasonsForStatus, reason) { + return fmt.Errorf("route condition reason %s not allowed for route condition type %s with status %s", reason, name, status) + } + + return nil +} + +func checkConditionStatus(status ConditionStatus) error { + switch status { + case ConditionStatusTrue, ConditionStatusFalse, ConditionStatusUnknown: + return nil + default: + return fmt.Errorf("unrecognized condition status: %q", status) + } +} diff --git a/vendor/github.com/hashicorp/consul/api/connect.go b/vendor/github.com/hashicorp/consul/api/connect.go index 1c1da9a..77be000 100644 --- a/vendor/github.com/hashicorp/consul/api/connect.go +++ b/vendor/github.com/hashicorp/consul/api/connect.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // TelemetryCollectorName is the service name for the Consul Telemetry Collector diff --git a/vendor/github.com/hashicorp/consul/api/connect_ca.go b/vendor/github.com/hashicorp/consul/api/connect_ca.go index 69c652d..8a5c9f8 100644 --- a/vendor/github.com/hashicorp/consul/api/connect_ca.go +++ b/vendor/github.com/hashicorp/consul/api/connect_ca.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/connect_intention.go b/vendor/github.com/hashicorp/consul/api/connect_intention.go index 0c2500f..e91c03e 100644 --- a/vendor/github.com/hashicorp/consul/api/connect_intention.go +++ b/vendor/github.com/hashicorp/consul/api/connect_intention.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -40,6 +43,10 @@ type Intention struct { // same level of tenancy (partition is local to cluster, peer is remote). SourcePeer string `json:",omitempty"` + // SourceSamenessGroup cannot be wildcards "*" and + // is not compatible with legacy intentions. + SourceSamenessGroup string `json:",omitempty"` + // SourceType is the type of the value for the source. SourceType IntentionSourceType diff --git a/vendor/github.com/hashicorp/consul/api/coordinate.go b/vendor/github.com/hashicorp/consul/api/coordinate.go index 7ef6ce2..b0269ad 100644 --- a/vendor/github.com/hashicorp/consul/api/coordinate.go +++ b/vendor/github.com/hashicorp/consul/api/coordinate.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/debug.go b/vendor/github.com/hashicorp/consul/api/debug.go index b7e80b8..e6b5dc5 100644 --- a/vendor/github.com/hashicorp/consul/api/debug.go +++ b/vendor/github.com/hashicorp/consul/api/debug.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/discovery_chain.go b/vendor/github.com/hashicorp/consul/api/discovery_chain.go index 4217603..4b6260c 100644 --- a/vendor/github.com/hashicorp/consul/api/discovery_chain.go +++ b/vendor/github.com/hashicorp/consul/api/discovery_chain.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -221,6 +224,7 @@ func (r *DiscoveryResolver) UnmarshalJSON(data []byte) error { // compiled form of ServiceResolverFailover type DiscoveryFailover struct { Targets []string + Policy ServiceResolverFailoverPolicy `json:",omitempty"` } // DiscoveryTarget represents all of the inputs necessary to use a resolver diff --git a/vendor/github.com/hashicorp/consul/api/event.go b/vendor/github.com/hashicorp/consul/api/event.go index ceded65..efba89d 100644 --- a/vendor/github.com/hashicorp/consul/api/event.go +++ b/vendor/github.com/hashicorp/consul/api/event.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/health.go b/vendor/github.com/hashicorp/consul/api/health.go index a89b4b7..a023002 100644 --- a/vendor/github.com/hashicorp/consul/api/health.go +++ b/vendor/github.com/hashicorp/consul/api/health.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -64,6 +67,7 @@ type HealthCheckDefinition struct { TLSServerName string TLSSkipVerify bool TCP string + TCPUseTLS bool UDP string GRPC string OSService string diff --git a/vendor/github.com/hashicorp/consul/api/internal.go b/vendor/github.com/hashicorp/consul/api/internal.go new file mode 100644 index 0000000..dee161a --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/internal.go @@ -0,0 +1,64 @@ +package api + +import "context" + +// Internal can be used to query endpoints that are intended for +// Hashicorp internal-use only. +type Internal struct { + c *Client +} + +// Internal returns a handle to endpoints that are for internal +// Hashicorp usage only. There is not guarantee that these will +// be backwards-compatible or supported, so usage of these is +// not encouraged. +func (c *Client) Internal() *Internal { + return &Internal{c} +} + +type AssignServiceManualVIPsRequest struct { + Service string + ManualVIPs []string +} + +type AssignServiceManualVIPsResponse struct { + ServiceFound bool `json:"Found"` + UnassignedFrom []PeeredServiceName +} + +type PeeredServiceName struct { + ServiceName CompoundServiceName + Peer string +} + +func (i *Internal) AssignServiceVirtualIP( + ctx context.Context, + service string, + manualVIPs []string, + wo *WriteOptions, +) (*AssignServiceManualVIPsResponse, *QueryMeta, error) { + req := i.c.newRequest("PUT", "/v1/internal/service-virtual-ip") + req.setWriteOptions(wo) + req.ctx = ctx + req.obj = AssignServiceManualVIPsRequest{ + Service: service, + ManualVIPs: manualVIPs, + } + rtt, resp, err := i.c.doRequest(req) + if err != nil { + return nil, nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, nil, err + } + + qm := &QueryMeta{RequestTime: rtt} + parseQueryMeta(resp, qm) + + var out AssignServiceManualVIPsResponse + if err := decodeBody(resp, &out); err != nil { + return nil, nil, err + } + return &out, qm, nil +} diff --git a/vendor/github.com/hashicorp/consul/api/kv.go b/vendor/github.com/hashicorp/consul/api/kv.go index 85a9d77..b9d330a 100644 --- a/vendor/github.com/hashicorp/consul/api/kv.go +++ b/vendor/github.com/hashicorp/consul/api/kv.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/lock.go b/vendor/github.com/hashicorp/consul/api/lock.go index 221a7ad..e9529f7 100644 --- a/vendor/github.com/hashicorp/consul/api/lock.go +++ b/vendor/github.com/hashicorp/consul/api/lock.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/namespace.go b/vendor/github.com/hashicorp/consul/api/namespace.go index 65cc6f3..98afd22 100644 --- a/vendor/github.com/hashicorp/consul/api/namespace.go +++ b/vendor/github.com/hashicorp/consul/api/namespace.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/operator.go b/vendor/github.com/hashicorp/consul/api/operator.go index 079e224..667dcd8 100644 --- a/vendor/github.com/hashicorp/consul/api/operator.go +++ b/vendor/github.com/hashicorp/consul/api/operator.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // Operator can be used to perform low-level operator tasks for Consul. diff --git a/vendor/github.com/hashicorp/consul/api/operator_area.go b/vendor/github.com/hashicorp/consul/api/operator_area.go index f9fa133..9228d89 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_area.go +++ b/vendor/github.com/hashicorp/consul/api/operator_area.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // The /v1/operator/area endpoints are available only in Consul Enterprise and diff --git a/vendor/github.com/hashicorp/consul/api/operator_audit.go b/vendor/github.com/hashicorp/consul/api/operator_audit.go new file mode 100644 index 0000000..5240d38 --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/operator_audit.go @@ -0,0 +1,40 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +// The /v1/operator/audit-hash endpoint is available only in Consul Enterprise and +// interact with its audit logging subsystem. + +package api + +type AuditHashRequest struct { + Input string +} + +type AuditHashResponse struct { + Hash string +} + +func (op *Operator) AuditHash(a *AuditHashRequest, q *QueryOptions) (*AuditHashResponse, error) { + r := op.c.newRequest("POST", "/v1/operator/audit-hash") + r.setQueryOptions(q) + r.obj = a + + rtt, resp, err := op.c.doRequest(r) + if err != nil { + return nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, err + } + + wm := &WriteMeta{} + wm.RequestTime = rtt + + var out AuditHashResponse + if err := decodeBody(resp, &out); err != nil { + return nil, err + } + + return &out, nil +} diff --git a/vendor/github.com/hashicorp/consul/api/operator_autopilot.go b/vendor/github.com/hashicorp/consul/api/operator_autopilot.go index 6ab5769..7628bf6 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_autopilot.go +++ b/vendor/github.com/hashicorp/consul/api/operator_autopilot.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/operator_keyring.go b/vendor/github.com/hashicorp/consul/api/operator_keyring.go index 6db31a2..aefec9e 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_keyring.go +++ b/vendor/github.com/hashicorp/consul/api/operator_keyring.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // keyringRequest is used for performing Keyring operations diff --git a/vendor/github.com/hashicorp/consul/api/operator_license.go b/vendor/github.com/hashicorp/consul/api/operator_license.go index 74eed3b..1e3496d 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_license.go +++ b/vendor/github.com/hashicorp/consul/api/operator_license.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/operator_raft.go b/vendor/github.com/hashicorp/consul/api/operator_raft.go index 1da20e8..d72c00c 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_raft.go +++ b/vendor/github.com/hashicorp/consul/api/operator_raft.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // RaftServer has information about a server in the Raft configuration. @@ -25,6 +28,9 @@ type RaftServer struct { // it's a non-voting server, which will be added in a future release of // Consul. Voter bool + + // LastIndex is the last log index this server has a record of in its Raft log. + LastIndex uint64 } // RaftConfiguration is returned when querying for the current Raft configuration. diff --git a/vendor/github.com/hashicorp/consul/api/operator_segment.go b/vendor/github.com/hashicorp/consul/api/operator_segment.go index 92b05d3..6115a7a 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_segment.go +++ b/vendor/github.com/hashicorp/consul/api/operator_segment.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // SegmentList returns all the available LAN segments. diff --git a/vendor/github.com/hashicorp/consul/api/operator_usage.go b/vendor/github.com/hashicorp/consul/api/operator_usage.go index d07e774..8977449 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_usage.go +++ b/vendor/github.com/hashicorp/consul/api/operator_usage.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api type Usage struct { @@ -7,6 +10,7 @@ type Usage struct { // ServiceUsage contains information about the number of services and service instances for a datacenter. type ServiceUsage struct { + Nodes int Services int ServiceInstances int ConnectServiceInstances map[string]int diff --git a/vendor/github.com/hashicorp/consul/api/partition.go b/vendor/github.com/hashicorp/consul/api/partition.go index 88edfb7..8467c31 100644 --- a/vendor/github.com/hashicorp/consul/api/partition.go +++ b/vendor/github.com/hashicorp/consul/api/partition.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/peering.go b/vendor/github.com/hashicorp/consul/api/peering.go index 34602c8..dd7780f 100644 --- a/vendor/github.com/hashicorp/consul/api/peering.go +++ b/vendor/github.com/hashicorp/consul/api/peering.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -44,6 +47,16 @@ type PeeringRemoteInfo struct { Partition string // Datacenter is the remote peer's datacenter. Datacenter string + Locality *Locality `json:",omitempty"` +} + +// Locality identifies where a given entity is running. +type Locality struct { + // Region is region the zone belongs to. + Region string + + // Zone is the zone the entity is running in. + Zone string } type Peering struct { diff --git a/vendor/github.com/hashicorp/consul/api/prepared_query.go b/vendor/github.com/hashicorp/consul/api/prepared_query.go index f47a583..8ebc852 100644 --- a/vendor/github.com/hashicorp/consul/api/prepared_query.go +++ b/vendor/github.com/hashicorp/consul/api/prepared_query.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // QueryFailoverOptions sets options about how we fail over if there are no @@ -26,6 +29,14 @@ type QueryFailoverTarget struct { // Datacenter specifies a datacenter to try during failover. Datacenter string + + // Partition specifies a partition to try during failover + // Note: Partition are available only in Consul Enterprise + Partition string `json:",omitempty"` + + // Namespace specifies a namespace to try during failover + // Note: Namespaces are available only in Consul Enterprise + Namespace string `json:",omitempty"` } // QueryDNSOptions controls settings when query results are served over DNS. @@ -40,9 +51,17 @@ type ServiceQuery struct { // Service is the service to query. Service string + // SamenessGroup specifies a sameness group to query. The first member of the Sameness Group will + // be targeted first on PQ execution and subsequent members will be targeted during failover scenarios. + // This field is mutually exclusive with Failover. + SamenessGroup string `json:",omitempty"` + // Namespace of the service to query Namespace string `json:",omitempty"` + // Partition of the service to query + Partition string `json:",omitempty"` + // Near allows baking in the name of a node to automatically distance- // sort from. The magic "_agent" value is supported, which sorts near // the agent which initiated the request by default. @@ -50,7 +69,7 @@ type ServiceQuery struct { // Failover controls what we do if there are no healthy nodes in the // local datacenter. - Failover QueryFailoverOptions + Failover QueryFailoverOptions `json:",omitempty"` // IgnoreCheckIDs is an optional list of health check IDs to ignore when // considering which nodes are healthy. It is useful as an emergency measure diff --git a/vendor/github.com/hashicorp/consul/api/raw.go b/vendor/github.com/hashicorp/consul/api/raw.go index 745a208..639513d 100644 --- a/vendor/github.com/hashicorp/consul/api/raw.go +++ b/vendor/github.com/hashicorp/consul/api/raw.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // Raw can be used to do raw queries against custom endpoints diff --git a/vendor/github.com/hashicorp/consul/api/semaphore.go b/vendor/github.com/hashicorp/consul/api/semaphore.go index 066ce33..9d98ff5 100644 --- a/vendor/github.com/hashicorp/consul/api/semaphore.go +++ b/vendor/github.com/hashicorp/consul/api/semaphore.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/session.go b/vendor/github.com/hashicorp/consul/api/session.go index 3f61acf..69fd77d 100644 --- a/vendor/github.com/hashicorp/consul/api/session.go +++ b/vendor/github.com/hashicorp/consul/api/session.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/snapshot.go b/vendor/github.com/hashicorp/consul/api/snapshot.go index b526b79..bcc80e5 100644 --- a/vendor/github.com/hashicorp/consul/api/snapshot.go +++ b/vendor/github.com/hashicorp/consul/api/snapshot.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/status.go b/vendor/github.com/hashicorp/consul/api/status.go index 86f943b..8c52eb2 100644 --- a/vendor/github.com/hashicorp/consul/api/status.go +++ b/vendor/github.com/hashicorp/consul/api/status.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // Status can be used to query the Status endpoints diff --git a/vendor/github.com/hashicorp/consul/api/txn.go b/vendor/github.com/hashicorp/consul/api/txn.go index 4aa06d9..59adafd 100644 --- a/vendor/github.com/hashicorp/consul/api/txn.go +++ b/vendor/github.com/hashicorp/consul/api/txn.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go b/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go index 8d306bf..fe28d15 100644 --- a/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go +++ b/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go @@ -32,6 +32,7 @@ func DefaultPooledTransport() *http.Transport { IdleConnTimeout: 90 * time.Second, TLSHandshakeTimeout: 10 * time.Second, ExpectContinueTimeout: 1 * time.Second, + ForceAttemptHTTP2: true, MaxIdleConnsPerHost: runtime.GOMAXPROCS(0) + 1, } return transport diff --git a/vendor/github.com/hashicorp/go-hclog/LICENSE b/vendor/github.com/hashicorp/go-hclog/LICENSE index abaf1e4..9938fb5 100644 --- a/vendor/github.com/hashicorp/go-hclog/LICENSE +++ b/vendor/github.com/hashicorp/go-hclog/LICENSE @@ -1,6 +1,4 @@ -MIT License - -Copyright (c) 2017 HashiCorp +Copyright (c) 2017 HashiCorp, Inc. Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/github.com/hashicorp/go-hclog/README.md b/vendor/github.com/hashicorp/go-hclog/README.md index 5d56f4b..21a17c5 100644 --- a/vendor/github.com/hashicorp/go-hclog/README.md +++ b/vendor/github.com/hashicorp/go-hclog/README.md @@ -17,11 +17,8 @@ JSON output mode for production. ## Stability Note -While this library is fully open source and HashiCorp will be maintaining it -(since we are and will be making extensive use of it), the API and output -format is subject to minor changes as we fully bake and vet it in our projects. -This notice will be removed once it's fully integrated into our major projects -and no further changes are anticipated. +This library has reached 1.0 stability. Its API can be considered solidified +and promised through future versions. ## Installation and Docs @@ -102,7 +99,7 @@ into all the callers. ### Using `hclog.Fmt()` ```go -var int totalBandwidth = 200 +totalBandwidth := 200 appLogger.Info("total bandwidth exceeded", "bandwidth", hclog.Fmt("%d GB/s", totalBandwidth)) ``` @@ -146,3 +143,6 @@ log.Printf("[DEBUG] %d", 42) Notice that if `appLogger` is initialized with the `INFO` log level _and_ you specify `InferLevels: true`, you will not see any output here. You must change `appLogger` to `DEBUG` to see output. See the docs for more information. + +If the log lines start with a timestamp you can use the +`InferLevelsWithTimestamp` option to try and ignore them. diff --git a/vendor/github.com/hashicorp/go-hclog/colorize_unix.go b/vendor/github.com/hashicorp/go-hclog/colorize_unix.go index 44aa9bf..d00816b 100644 --- a/vendor/github.com/hashicorp/go-hclog/colorize_unix.go +++ b/vendor/github.com/hashicorp/go-hclog/colorize_unix.go @@ -1,3 +1,7 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +//go:build !windows // +build !windows package hclog @@ -6,22 +10,35 @@ import ( "github.com/mattn/go-isatty" ) +// hasFD is used to check if the writer has an Fd value to check +// if it's a terminal. +type hasFD interface { + Fd() uintptr +} + // setColorization will mutate the values of this logger -// to approperately configure colorization options. It provides +// to appropriately configure colorization options. It provides // a wrapper to the output stream on Windows systems. func (l *intLogger) setColorization(opts *LoggerOptions) { - switch opts.Color { - case ColorOff: - fallthrough - case ForceColor: + if opts.Color != AutoColor { return - case AutoColor: - fi := l.checkWriterIsFile() - isUnixTerm := isatty.IsTerminal(fi.Fd()) - isCygwinTerm := isatty.IsCygwinTerminal(fi.Fd()) - isTerm := isUnixTerm || isCygwinTerm - if !isTerm { + } + + if sc, ok := l.writer.w.(SupportsColor); ok { + if !sc.SupportsColor() { + l.headerColor = ColorOff l.writer.color = ColorOff } + return + } + + fi, ok := l.writer.w.(hasFD) + if !ok { + return + } + + if !isatty.IsTerminal(fi.Fd()) { + l.headerColor = ColorOff + l.writer.color = ColorOff } } diff --git a/vendor/github.com/hashicorp/go-hclog/colorize_windows.go b/vendor/github.com/hashicorp/go-hclog/colorize_windows.go index 23486b6..2c3fb9e 100644 --- a/vendor/github.com/hashicorp/go-hclog/colorize_windows.go +++ b/vendor/github.com/hashicorp/go-hclog/colorize_windows.go @@ -1,3 +1,7 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +//go:build windows // +build windows package hclog @@ -6,28 +10,32 @@ import ( "os" colorable "github.com/mattn/go-colorable" - "github.com/mattn/go-isatty" ) // setColorization will mutate the values of this logger -// to approperately configure colorization options. It provides +// to appropriately configure colorization options. It provides // a wrapper to the output stream on Windows systems. func (l *intLogger) setColorization(opts *LoggerOptions) { - switch opts.Color { - case ColorOff: + if opts.Color == ColorOff { + return + } + + fi, ok := l.writer.w.(*os.File) + if !ok { + l.writer.color = ColorOff + l.headerColor = ColorOff return - case ForceColor: - fi := l.checkWriterIsFile() - l.writer.w = colorable.NewColorable(fi) - case AutoColor: - fi := l.checkWriterIsFile() - isUnixTerm := isatty.IsTerminal(os.Stdout.Fd()) - isCygwinTerm := isatty.IsCygwinTerminal(os.Stdout.Fd()) - isTerm := isUnixTerm || isCygwinTerm - if !isTerm { - l.writer.color = ColorOff - return - } - l.writer.w = colorable.NewColorable(fi) + } + + cfi := colorable.NewColorable(fi) + + // NewColorable detects if color is possible and if it's not, then it + // returns the original value. So we can test if we got the original + // value back to know if color is possible. + if cfi == fi { + l.writer.color = ColorOff + l.headerColor = ColorOff + } else { + l.writer.w = cfi } } diff --git a/vendor/github.com/hashicorp/go-hclog/context.go b/vendor/github.com/hashicorp/go-hclog/context.go index 7815f50..eb5aba5 100644 --- a/vendor/github.com/hashicorp/go-hclog/context.go +++ b/vendor/github.com/hashicorp/go-hclog/context.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( diff --git a/vendor/github.com/hashicorp/go-hclog/exclude.go b/vendor/github.com/hashicorp/go-hclog/exclude.go index cfd4307..4b73ba5 100644 --- a/vendor/github.com/hashicorp/go-hclog/exclude.go +++ b/vendor/github.com/hashicorp/go-hclog/exclude.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( diff --git a/vendor/github.com/hashicorp/go-hclog/global.go b/vendor/github.com/hashicorp/go-hclog/global.go index 22ebc57..a7403f5 100644 --- a/vendor/github.com/hashicorp/go-hclog/global.go +++ b/vendor/github.com/hashicorp/go-hclog/global.go @@ -1,7 +1,11 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( "sync" + "time" ) var ( @@ -14,17 +18,18 @@ var ( DefaultOptions = &LoggerOptions{ Level: DefaultLevel, Output: DefaultOutput, + TimeFn: time.Now, } ) // Default returns a globally held logger. This can be a good starting -// place, and then you can use .With() and .Name() to create sub-loggers +// place, and then you can use .With() and .Named() to create sub-loggers // to be used in more specific contexts. // The value of the Default logger can be set via SetDefault() or by // changing the options in DefaultOptions. // // This method is goroutine safe, returning a global from memory, but -// cause should be used if SetDefault() is called it random times +// care should be used if SetDefault() is called it random times // in the program as that may result in race conditions and an unexpected // Logger being returned. func Default() Logger { diff --git a/vendor/github.com/hashicorp/go-hclog/interceptlogger.go b/vendor/github.com/hashicorp/go-hclog/interceptlogger.go index 08a6677..e9b1c18 100644 --- a/vendor/github.com/hashicorp/go-hclog/interceptlogger.go +++ b/vendor/github.com/hashicorp/go-hclog/interceptlogger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -18,8 +21,13 @@ type interceptLogger struct { } func NewInterceptLogger(opts *LoggerOptions) InterceptLogger { + l := newLogger(opts) + if l.callerOffset > 0 { + // extra frames for interceptLogger.{Warn,Info,Log,etc...}, and interceptLogger.log + l.callerOffset += 2 + } intercept := &interceptLogger{ - Logger: New(opts), + Logger: l, mu: new(sync.Mutex), sinkCount: new(int32), Sinks: make(map[SinkAdapter]struct{}), @@ -31,6 +39,14 @@ func NewInterceptLogger(opts *LoggerOptions) InterceptLogger { } func (i *interceptLogger) Log(level Level, msg string, args ...interface{}) { + i.log(level, msg, args...) +} + +// log is used to make the caller stack frame lookup consistent. If Warn,Info,etc +// all called Log then direct calls to Log would have a different stack frame +// depth. By having all the methods call the same helper we ensure the stack +// frame depth is the same. +func (i *interceptLogger) log(level Level, msg string, args ...interface{}) { i.Logger.Log(level, msg, args...) if atomic.LoadInt32(i.sinkCount) == 0 { return @@ -45,72 +61,27 @@ func (i *interceptLogger) Log(level Level, msg string, args ...interface{}) { // Emit the message and args at TRACE level to log and sinks func (i *interceptLogger) Trace(msg string, args ...interface{}) { - i.Logger.Trace(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Trace, msg, i.retrieveImplied(args...)...) - } + i.log(Trace, msg, args...) } // Emit the message and args at DEBUG level to log and sinks func (i *interceptLogger) Debug(msg string, args ...interface{}) { - i.Logger.Debug(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Debug, msg, i.retrieveImplied(args...)...) - } + i.log(Debug, msg, args...) } // Emit the message and args at INFO level to log and sinks func (i *interceptLogger) Info(msg string, args ...interface{}) { - i.Logger.Info(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Info, msg, i.retrieveImplied(args...)...) - } + i.log(Info, msg, args...) } // Emit the message and args at WARN level to log and sinks func (i *interceptLogger) Warn(msg string, args ...interface{}) { - i.Logger.Warn(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Warn, msg, i.retrieveImplied(args...)...) - } + i.log(Warn, msg, args...) } // Emit the message and args at ERROR level to log and sinks func (i *interceptLogger) Error(msg string, args ...interface{}) { - i.Logger.Error(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Error, msg, i.retrieveImplied(args...)...) - } + i.log(Error, msg, args...) } func (i *interceptLogger) retrieveImplied(args ...interface{}) []interface{} { @@ -123,17 +94,11 @@ func (i *interceptLogger) retrieveImplied(args ...interface{}) []interface{} { return cp } -// Create a new sub-Logger that a name decending from the current name. +// Create a new sub-Logger that a name descending from the current name. // This is used to create a subsystem specific Logger. // Registered sinks will subscribe to these messages as well. func (i *interceptLogger) Named(name string) Logger { - var sub interceptLogger - - sub = *i - - sub.Logger = i.Logger.Named(name) - - return &sub + return i.NamedIntercept(name) } // Create a new sub-Logger with an explicit name. This ignores the current @@ -141,13 +106,7 @@ func (i *interceptLogger) Named(name string) Logger { // within the normal hierarchy. Registered sinks will subscribe // to these messages as well. func (i *interceptLogger) ResetNamed(name string) Logger { - var sub interceptLogger - - sub = *i - - sub.Logger = i.Logger.ResetNamed(name) - - return &sub + return i.ResetNamedIntercept(name) } // Create a new sub-Logger that a name decending from the current name. @@ -157,9 +116,7 @@ func (i *interceptLogger) NamedIntercept(name string) InterceptLogger { var sub interceptLogger sub = *i - sub.Logger = i.Logger.Named(name) - return &sub } @@ -171,9 +128,7 @@ func (i *interceptLogger) ResetNamedIntercept(name string) InterceptLogger { var sub interceptLogger sub = *i - sub.Logger = i.Logger.ResetNamed(name) - return &sub } @@ -210,22 +165,28 @@ func (i *interceptLogger) DeregisterSink(sink SinkAdapter) { atomic.AddInt32(i.sinkCount, -1) } -// Create a *log.Logger that will send it's data through this Logger. This -// allows packages that expect to be using the standard library to log to -// actually use this logger, which will also send to any registered sinks. func (i *interceptLogger) StandardLoggerIntercept(opts *StandardLoggerOptions) *log.Logger { + return i.StandardLogger(opts) +} + +func (i *interceptLogger) StandardLogger(opts *StandardLoggerOptions) *log.Logger { if opts == nil { opts = &StandardLoggerOptions{} } - return log.New(i.StandardWriterIntercept(opts), "", 0) + return log.New(i.StandardWriter(opts), "", 0) } func (i *interceptLogger) StandardWriterIntercept(opts *StandardLoggerOptions) io.Writer { + return i.StandardWriter(opts) +} + +func (i *interceptLogger) StandardWriter(opts *StandardLoggerOptions) io.Writer { return &stdlogAdapter{ - log: i, - inferLevels: opts.InferLevels, - forceLevel: opts.ForceLevel, + log: i, + inferLevels: opts.InferLevels, + inferLevelsWithTimestamp: opts.InferLevelsWithTimestamp, + forceLevel: opts.ForceLevel, } } diff --git a/vendor/github.com/hashicorp/go-hclog/intlogger.go b/vendor/github.com/hashicorp/go-hclog/intlogger.go index 7158125..b45064a 100644 --- a/vendor/github.com/hashicorp/go-hclog/intlogger.go +++ b/vendor/github.com/hashicorp/go-hclog/intlogger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -8,9 +11,7 @@ import ( "fmt" "io" "log" - "os" "reflect" - "regexp" "runtime" "sort" "strconv" @@ -18,14 +19,20 @@ import ( "sync" "sync/atomic" "time" + "unicode" + "unicode/utf8" "github.com/fatih/color" ) -// TimeFormat to use for logging. This is a version of RFC3339 that contains -// contains millisecond precision +// TimeFormat is the time format to use for plain (non-JSON) output. +// This is a version of RFC3339 that contains millisecond precision. const TimeFormat = "2006-01-02T15:04:05.000Z0700" +// TimeFormatJSON is the time format to use for JSON output. +// This is a version of RFC3339 that contains microsecond precision. +const TimeFormatJSON = "2006-01-02T15:04:05.000000Z07:00" + // errJsonUnsupportedTypeMsg is included in log json entries, if an arg cannot be serialized to json const errJsonUnsupportedTypeMsg = "logging contained values that don't serialize to json" @@ -45,6 +52,12 @@ var ( Warn: color.New(color.FgHiYellow), Error: color.New(color.FgHiRed), } + + faintBoldColor = color.New(color.Faint, color.Bold) + faintColor = color.New(color.Faint) + faintMultiLinePrefix = faintColor.Sprint(" | ") + faintFieldSeparator = faintColor.Sprint("=") + faintFieldSeparatorWithNewLine = faintColor.Sprint("=\n") ) // Make sure that intLogger is a Logger @@ -53,10 +66,12 @@ var _ Logger = &intLogger{} // intLogger is an internal logger implementation. Internal in that it is // defined entirely by this package. type intLogger struct { - json bool - caller bool - name string - timeFormat string + json bool + callerOffset int + name string + timeFormat string + timeFn TimeFunction + disableTime bool // This is an interface so that it's shared by any derived loggers, since // those derived loggers share the bufio.Writer as well. @@ -64,9 +79,17 @@ type intLogger struct { writer *writer level *int32 + headerColor ColorOption + fieldColor ColorOption + implied []interface{} exclude func(level Level, msg string, args ...interface{}) bool + + // create subloggers with their own level setting + independentLevels bool + + subloggerHook func(sub Logger) Logger } // New returns a configured logger. @@ -77,7 +100,12 @@ func New(opts *LoggerOptions) Logger { // NewSinkAdapter returns a SinkAdapter with configured settings // defined by LoggerOptions func NewSinkAdapter(opts *LoggerOptions) SinkAdapter { - return newLogger(opts) + l := newLogger(opts) + if l.callerOffset > 0 { + // extra frames for interceptLogger.{Warn,Info,Log,etc...}, and SinkAdapter.Accept + l.callerOffset += 2 + } + return l } func newLogger(opts *LoggerOptions) *intLogger { @@ -100,30 +128,69 @@ func newLogger(opts *LoggerOptions) *intLogger { mutex = new(sync.Mutex) } - l := &intLogger{ - json: opts.JSONFormat, - caller: opts.IncludeLocation, - name: opts.Name, - timeFormat: TimeFormat, - mutex: mutex, - writer: newWriter(output, opts.Color), - level: new(int32), - exclude: opts.Exclude, + var ( + primaryColor ColorOption = ColorOff + headerColor ColorOption = ColorOff + fieldColor ColorOption = ColorOff + ) + switch { + case opts.ColorHeaderOnly: + headerColor = opts.Color + case opts.ColorHeaderAndFields: + fieldColor = opts.Color + headerColor = opts.Color + default: + primaryColor = opts.Color } - l.setColorization(opts) + l := &intLogger{ + json: opts.JSONFormat, + name: opts.Name, + timeFormat: TimeFormat, + timeFn: time.Now, + disableTime: opts.DisableTime, + mutex: mutex, + writer: newWriter(output, primaryColor), + level: new(int32), + exclude: opts.Exclude, + independentLevels: opts.IndependentLevels, + headerColor: headerColor, + fieldColor: fieldColor, + subloggerHook: opts.SubloggerHook, + } + if opts.IncludeLocation { + l.callerOffset = offsetIntLogger + opts.AdditionalLocationOffset + } - if opts.DisableTime { - l.timeFormat = "" - } else if opts.TimeFormat != "" { + if l.json { + l.timeFormat = TimeFormatJSON + } + if opts.TimeFn != nil { + l.timeFn = opts.TimeFn + } + if opts.TimeFormat != "" { l.timeFormat = opts.TimeFormat } + if l.subloggerHook == nil { + l.subloggerHook = identityHook + } + + l.setColorization(opts) + atomic.StoreInt32(l.level, int32(level)) return l } +func identityHook(logger Logger) Logger { + return logger +} + +// offsetIntLogger is the stack frame offset in the call stack for the caller to +// one of the Warn, Info, Log, etc methods. +const offsetIntLogger = 3 + // Log a message and a set of key/value pairs if the given level is at // or more severe that the threshold configured in the Logger. func (l *intLogger) log(name string, level Level, msg string, args ...interface{}) { @@ -131,7 +198,7 @@ func (l *intLogger) log(name string, level Level, msg string, args ...interface{ return } - t := time.Now() + t := l.timeFn() l.mutex.Lock() defer l.mutex.Unlock() @@ -178,34 +245,56 @@ func trimCallerPath(path string) string { return path[idx+1:] } -var logImplFile = regexp.MustCompile(`.+intlogger.go|.+interceptlogger.go$`) +// isNormal indicates if the rune is one allowed to exist as an unquoted +// string value. This is a subset of ASCII, `-` through `~`. +func isNormal(r rune) bool { + return 0x2D <= r && r <= 0x7E // - through ~ +} -// Non-JSON logging format function +// needsQuoting returns false if all the runes in string are normal, according +// to isNormal +func needsQuoting(str string) bool { + for _, r := range str { + if !isNormal(r) { + return true + } + } + + return false +} + +// logPlain is the non-JSON logging format function which writes directly +// to the underlying writer the logger was initialized with. +// +// If the logger was initialized with a color function, it also handles +// applying the color to the log message. +// +// Color Options +// 1. No color. +// 2. Color the whole log line, based on the level. +// 3. Color only the header (level) part of the log line. +// 4. Color both the header and fields of the log line. func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, args ...interface{}) { - if len(l.timeFormat) > 0 { + + if !l.disableTime { l.writer.WriteString(t.Format(l.timeFormat)) l.writer.WriteByte(' ') } s, ok := _levelToBracket[level] if ok { - l.writer.WriteString(s) + if l.headerColor != ColorOff { + color := _levelToColor[level] + color.Fprint(l.writer, s) + } else { + l.writer.WriteString(s) + } } else { l.writer.WriteString("[?????]") } - offset := 3 - if l.caller { - // Check if the caller is inside our package and inside - // a logger implementation file - if _, file, _, ok := runtime.Caller(3); ok { - match := logImplFile.MatchString(file) - if match { - offset = 4 - } - } - - if _, file, line, ok := runtime.Caller(offset); ok { + if l.callerOffset > 0 { + if _, file, line, ok := runtime.Caller(l.callerOffset); ok { l.writer.WriteByte(' ') l.writer.WriteString(trimCallerPath(file)) l.writer.WriteByte(':') @@ -218,16 +307,19 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, if name != "" { l.writer.WriteString(name) - l.writer.WriteString(": ") + if msg != "" { + l.writer.WriteString(": ") + l.writer.WriteString(msg) + } + } else if msg != "" { + l.writer.WriteString(msg) } - l.writer.WriteString(msg) - args = append(l.implied, args...) var stacktrace CapturedStacktrace - if args != nil && len(args) > 0 { + if len(args) > 0 { if len(args)%2 != 0 { cs, ok := args[len(args)-1].(CapturedStacktrace) if ok { @@ -241,16 +333,23 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, l.writer.WriteByte(':') + // Handle the field arguments, which come in pairs (key=val). FOR: for i := 0; i < len(args); i = i + 2 { var ( + key string val string raw bool ) + // Convert the field value to a string. switch st := args[i+1].(type) { case string: val = st + if st == "" { + val = `""` + raw = true + } case int: val = strconv.FormatInt(int64(st), 10) case int64: @@ -282,6 +381,9 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, continue FOR case Format: val = fmt.Sprintf(st[0].(string), st[1:]...) + case Quote: + raw = true + val = strconv.Quote(string(st)) default: v := reflect.ValueOf(st) if v.Kind() == reflect.Slice { @@ -292,20 +394,57 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, } } - l.writer.WriteByte(' ') + // Convert the field key to a string. switch st := args[i].(type) { case string: - l.writer.WriteString(st) + key = st default: - l.writer.WriteString(fmt.Sprintf("%s", st)) + key = fmt.Sprintf("%s", st) } - l.writer.WriteByte('=') - if !raw && strings.ContainsAny(val, " \t\n\r") { + // Optionally apply the ANSI "faint" and "bold" + // SGR values to the key. + if l.fieldColor != ColorOff { + key = faintBoldColor.Sprint(key) + } + + // Values may contain multiple lines, and that format + // is preserved, with each line prefixed with a " | " + // to show it's part of a collection of lines. + // + // Values may also need quoting, if not all the runes + // in the value string are "normal", like if they + // contain ANSI escape sequences. + if strings.Contains(val, "\n") { + l.writer.WriteString("\n ") + l.writer.WriteString(key) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparatorWithNewLine) + writeIndent(l.writer, val, faintMultiLinePrefix) + } else { + l.writer.WriteString("=\n") + writeIndent(l.writer, val, " | ") + } + l.writer.WriteString(" ") + } else if !raw && needsQuoting(val) { + l.writer.WriteByte(' ') + l.writer.WriteString(key) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparator) + } else { + l.writer.WriteByte('=') + } l.writer.WriteByte('"') - l.writer.WriteString(val) + writeEscapedForOutput(l.writer, val, true) l.writer.WriteByte('"') } else { + l.writer.WriteByte(' ') + l.writer.WriteString(key) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparator) + } else { + l.writer.WriteByte('=') + } l.writer.WriteString(val) } } @@ -315,9 +454,108 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, if stacktrace != "" { l.writer.WriteString(string(stacktrace)) + l.writer.WriteString("\n") } } +func writeIndent(w *writer, str string, indent string) { + for { + nl := strings.IndexByte(str, "\n"[0]) + if nl == -1 { + if str != "" { + w.WriteString(indent) + writeEscapedForOutput(w, str, false) + w.WriteString("\n") + } + return + } + + w.WriteString(indent) + writeEscapedForOutput(w, str[:nl], false) + w.WriteString("\n") + str = str[nl+1:] + } +} + +func needsEscaping(str string) bool { + for _, b := range str { + if !unicode.IsPrint(b) || b == '"' { + return true + } + } + + return false +} + +const ( + lowerhex = "0123456789abcdef" +) + +var bufPool = sync.Pool{ + New: func() interface{} { + return new(bytes.Buffer) + }, +} + +func writeEscapedForOutput(w io.Writer, str string, escapeQuotes bool) { + if !needsEscaping(str) { + w.Write([]byte(str)) + return + } + + bb := bufPool.Get().(*bytes.Buffer) + bb.Reset() + + defer bufPool.Put(bb) + + for _, r := range str { + if escapeQuotes && r == '"' { + bb.WriteString(`\"`) + } else if unicode.IsPrint(r) { + bb.WriteRune(r) + } else { + switch r { + case '\a': + bb.WriteString(`\a`) + case '\b': + bb.WriteString(`\b`) + case '\f': + bb.WriteString(`\f`) + case '\n': + bb.WriteString(`\n`) + case '\r': + bb.WriteString(`\r`) + case '\t': + bb.WriteString(`\t`) + case '\v': + bb.WriteString(`\v`) + default: + switch { + case r < ' ': + bb.WriteString(`\x`) + bb.WriteByte(lowerhex[byte(r)>>4]) + bb.WriteByte(lowerhex[byte(r)&0xF]) + case !utf8.ValidRune(r): + r = 0xFFFD + fallthrough + case r < 0x10000: + bb.WriteString(`\u`) + for s := 12; s >= 0; s -= 4 { + bb.WriteByte(lowerhex[r>>uint(s)&0xF]) + } + default: + bb.WriteString(`\U`) + for s := 28; s >= 0; s -= 4 { + bb.WriteByte(lowerhex[r>>uint(s)&0xF]) + } + } + } + } + } + + w.Write(bb.Bytes()) +} + func (l *intLogger) renderSlice(v reflect.Value) string { var buf bytes.Buffer @@ -334,22 +572,19 @@ func (l *intLogger) renderSlice(v reflect.Value) string { switch sv.Kind() { case reflect.String: - val = sv.String() + val = strconv.Quote(sv.String()) case reflect.Int, reflect.Int16, reflect.Int32, reflect.Int64: val = strconv.FormatInt(sv.Int(), 10) case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64: val = strconv.FormatUint(sv.Uint(), 10) default: val = fmt.Sprintf("%v", sv.Interface()) + if strings.ContainsAny(val, " \t\n\r") { + val = strconv.Quote(val) + } } - if strings.ContainsAny(val, " \t\n\r") { - buf.WriteByte('"') - buf.WriteString(val) - buf.WriteByte('"') - } else { - buf.WriteString(val) - } + buf.WriteString(val) } buf.WriteRune(']') @@ -415,8 +650,10 @@ func (l *intLogger) logJSON(t time.Time, name string, level Level, msg string, a func (l intLogger) jsonMapEntry(t time.Time, name string, level Level, msg string) map[string]interface{} { vals := map[string]interface{}{ - "@message": msg, - "@timestamp": t.Format("2006-01-02T15:04:05.000000Z07:00"), + "@message": msg, + } + if !l.disableTime { + vals["@timestamp"] = t.Format(l.timeFormat) } var levelStr string @@ -441,8 +678,8 @@ func (l intLogger) jsonMapEntry(t time.Time, name string, level Level, msg strin vals["@module"] = name } - if l.caller { - if _, file, line, ok := runtime.Caller(4); ok { + if l.callerOffset > 0 { + if _, file, line, ok := runtime.Caller(l.callerOffset + 1); ok { vals["@caller"] = fmt.Sprintf("%s:%d", file, line) } } @@ -517,7 +754,7 @@ func (l *intLogger) With(args ...interface{}) Logger { args = args[:len(args)-1] } - sl := *l + sl := l.copy() result := make(map[string]interface{}, len(l.implied)+len(args)) keys := make([]string, 0, len(l.implied)+len(args)) @@ -551,13 +788,13 @@ func (l *intLogger) With(args ...interface{}) Logger { sl.implied = append(sl.implied, MissingKey, extra) } - return &sl + return l.subloggerHook(sl) } // Create a new sub-Logger that a name decending from the current name. // This is used to create a subsystem specific Logger. func (l *intLogger) Named(name string) Logger { - sl := *l + sl := l.copy() if sl.name != "" { sl.name = sl.name + "." + name @@ -565,18 +802,18 @@ func (l *intLogger) Named(name string) Logger { sl.name = name } - return &sl + return l.subloggerHook(sl) } // Create a new sub-Logger with an explicit name. This ignores the current // name. This is used to create a standalone logger that doesn't fall // within the normal hierarchy. func (l *intLogger) ResetNamed(name string) Logger { - sl := *l + sl := l.copy() sl.name = name - return &sl + return l.subloggerHook(sl) } func (l *intLogger) ResetOutput(opts *LoggerOptions) error { @@ -620,6 +857,11 @@ func (l *intLogger) SetLevel(level Level) { atomic.StoreInt32(l.level, int32(level)) } +// Returns the current level +func (l *intLogger) GetLevel() Level { + return Level(atomic.LoadInt32(l.level)) +} + // Create a *log.Logger that will send it's data through this Logger. This // allows packages that expect to be using the standard library log to actually // use this logger. @@ -632,21 +874,19 @@ func (l *intLogger) StandardLogger(opts *StandardLoggerOptions) *log.Logger { } func (l *intLogger) StandardWriter(opts *StandardLoggerOptions) io.Writer { - return &stdlogAdapter{ - log: l, - inferLevels: opts.InferLevels, - forceLevel: opts.ForceLevel, + newLog := *l + if l.callerOffset > 0 { + // the stack is + // logger.printf() -> l.Output() ->l.out.writer(hclog:stdlogAdaptor.write) -> hclog:stdlogAdaptor.dispatch() + // So plus 4. + newLog.callerOffset = l.callerOffset + 4 } -} - -// checks if the underlying io.Writer is a file, and -// panics if not. For use by colorization. -func (l *intLogger) checkWriterIsFile() *os.File { - fi, ok := l.writer.w.(*os.File) - if !ok { - panic("Cannot enable coloring of non-file Writers") + return &stdlogAdapter{ + log: &newLog, + inferLevels: opts.InferLevels, + inferLevelsWithTimestamp: opts.InferLevelsWithTimestamp, + forceLevel: opts.ForceLevel, } - return fi } // Accept implements the SinkAdapter interface @@ -663,3 +903,16 @@ func (i *intLogger) ImpliedArgs() []interface{} { func (i *intLogger) Name() string { return i.name } + +// copy returns a shallow copy of the intLogger, replacing the level pointer +// when necessary +func (l *intLogger) copy() *intLogger { + sl := *l + + if l.independentLevels { + sl.level = new(int32) + *sl.level = *l.level + } + + return &sl +} diff --git a/vendor/github.com/hashicorp/go-hclog/logger.go b/vendor/github.com/hashicorp/go-hclog/logger.go index 8d5eed7..947ac0c 100644 --- a/vendor/github.com/hashicorp/go-hclog/logger.go +++ b/vendor/github.com/hashicorp/go-hclog/logger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -5,10 +8,11 @@ import ( "log" "os" "strings" + "time" ) var ( - //DefaultOutput is used as the default log output. + // DefaultOutput is used as the default log output. DefaultOutput io.Writer = os.Stderr // DefaultLevel is used as the default log level. @@ -27,7 +31,7 @@ const ( // of actions in code, such as function enters/exits, etc. Trace Level = 1 - // Debug information for programmer lowlevel analysis. + // Debug information for programmer low-level analysis. Debug Level = 2 // Info information about steady state operations. @@ -38,15 +42,18 @@ const ( // Error information about unrecoverable events. Error Level = 5 + + // Off disables all logging output. + Off Level = 6 ) -// Format is a simple convience type for when formatting is required. When +// Format is a simple convenience type for when formatting is required. When // processing a value of this type, the logger automatically treats the first // argument as a Printf formatting string and passes the rest as the values // to be formatted. For example: L.Info(Fmt{"%d beans/day", beans}). type Format []interface{} -// Fmt returns a Format type. This is a convience function for creating a Format +// Fmt returns a Format type. This is a convenience function for creating a Format // type. func Fmt(str string, args ...interface{}) Format { return append(Format{str}, args...) @@ -64,6 +71,12 @@ type Octal int // text output. For example: L.Info("bits", Binary(17)) type Binary int +// A simple shortcut to format strings with Go quoting. Control and +// non-printable characters will be escaped with their backslash equivalents in +// output. Intended for untrusted or multiline strings which should be logged +// as concisely as possible. +type Quote string + // ColorOption expresses how the output should be colored, if at all. type ColorOption uint8 @@ -79,6 +92,13 @@ const ( ForceColor ) +// SupportsColor is an optional interface that can be implemented by the output +// value. If implemented and SupportsColor() returns true, then AutoColor will +// enable colorization. +type SupportsColor interface { + SupportsColor() bool +} + // LevelFromString returns a Level type for the named log level, or "NoLevel" if // the level string is invalid. This facilitates setting the log level via // config or environment variable by name in a predictable way. @@ -96,6 +116,8 @@ func LevelFromString(levelStr string) Level { return Warn case "error": return Error + case "off": + return Off default: return NoLevel } @@ -115,12 +137,14 @@ func (l Level) String() string { return "error" case NoLevel: return "none" + case Off: + return "off" default: return "unknown" } } -// Logger describes the interface that must be implemeted by all loggers. +// Logger describes the interface that must be implemented by all loggers. type Logger interface { // Args are alternating key, val pairs // keys must be strings @@ -179,10 +203,14 @@ type Logger interface { // the current name as well. ResetNamed(name string) Logger - // Updates the level. This should affect all sub-loggers as well. If an + // Updates the level. This should affect all related loggers as well, + // unless they were created with IndependentLevels. If an // implementation cannot update the level on the fly, it should no-op. SetLevel(level Level) + // Returns the current level + GetLevel() Level + // Return a value that conforms to the stdlib log.Logger interface StandardLogger(opts *StandardLoggerOptions) *log.Logger @@ -198,6 +226,15 @@ type StandardLoggerOptions struct { // [DEBUG] and strip it off before reapplying it. InferLevels bool + // Indicate that some minimal parsing should be done on strings to try + // and detect their level and re-emit them while ignoring possible + // timestamp values in the beginning of the string. + // This supports the strings like [ERROR], [ERR] [TRACE], [WARN], [INFO], + // [DEBUG] and strip it off before reapplying it. + // The timestamp detection may result in false positives and incomplete + // string outputs. + InferLevelsWithTimestamp bool + // ForceLevel is used to force all output from the standard logger to be at // the specified level. Similar to InferLevels, this will strip any level // prefix contained in the logged string before applying the forced level. @@ -205,12 +242,14 @@ type StandardLoggerOptions struct { ForceLevel Level } +type TimeFunction = func() time.Time + // LoggerOptions can be used to configure a new logger. type LoggerOptions struct { // Name of the subsystem to prefix logs with Name string - // The threshold for the logger. Anything less severe is supressed + // The threshold for the logger. Anything less severe is suppressed Level Level // Where to write the logs to. Defaults to os.Stderr if nil @@ -227,22 +266,49 @@ type LoggerOptions struct { // Include file and line information in each log line IncludeLocation bool + // AdditionalLocationOffset is the number of additional stack levels to skip + // when finding the file and line information for the log line + AdditionalLocationOffset int + // The time format to use instead of the default TimeFormat string + // A function which is called to get the time object that is formatted using `TimeFormat` + TimeFn TimeFunction + // Control whether or not to display the time at all. This is required // because setting TimeFormat to empty assumes the default format. DisableTime bool - // Color the output. On Windows, colored logs are only avaiable for io.Writers that + // Color the output. On Windows, colored logs are only available for io.Writers that // are concretely instances of *os.File. Color ColorOption + // Only color the header, not the body. This can help with readability of long messages. + ColorHeaderOnly bool + + // Color the header and message body fields. This can help with readability + // of long messages with multiple fields. + ColorHeaderAndFields bool + // A function which is called with the log information and if it returns true the value // should not be logged. // This is useful when interacting with a system that you wish to suppress the log // message for (because it's too noisy, etc) Exclude func(level Level, msg string, args ...interface{}) bool + + // IndependentLevels causes subloggers to be created with an independent + // copy of this logger's level. This means that using SetLevel on this + // logger will not affect any subloggers, and SetLevel on any subloggers + // will not affect the parent or sibling loggers. + IndependentLevels bool + + // SubloggerHook registers a function that is called when a sublogger via + // Named, With, or ResetNamed is created. If defined, the function is passed + // the newly created Logger and the returned Logger is returned from the + // original function. This option allows customization via interception and + // wrapping of Logger instances. + SubloggerHook func(sub Logger) Logger } // InterceptLogger describes the interface for using a logger @@ -271,10 +337,10 @@ type InterceptLogger interface { // the current name as well. ResetNamedIntercept(name string) InterceptLogger - // Return a value that conforms to the stdlib log.Logger interface + // Deprecated: use StandardLogger StandardLoggerIntercept(opts *StandardLoggerOptions) *log.Logger - // Return a value that conforms to io.Writer, which can be passed into log.SetOutput() + // Deprecated: use StandardWriter StandardWriterIntercept(opts *StandardLoggerOptions) io.Writer } diff --git a/vendor/github.com/hashicorp/go-hclog/nulllogger.go b/vendor/github.com/hashicorp/go-hclog/nulllogger.go index bc14f77..d43da80 100644 --- a/vendor/github.com/hashicorp/go-hclog/nulllogger.go +++ b/vendor/github.com/hashicorp/go-hclog/nulllogger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -49,6 +52,8 @@ func (l *nullLogger) ResetNamed(name string) Logger { return l } func (l *nullLogger) SetLevel(level Level) {} +func (l *nullLogger) GetLevel() Level { return NoLevel } + func (l *nullLogger) StandardLogger(opts *StandardLoggerOptions) *log.Logger { return log.New(l.StandardWriter(opts), "", log.LstdFlags) } diff --git a/vendor/github.com/hashicorp/go-hclog/stdlog.go b/vendor/github.com/hashicorp/go-hclog/stdlog.go index f35d875..03739b6 100644 --- a/vendor/github.com/hashicorp/go-hclog/stdlog.go +++ b/vendor/github.com/hashicorp/go-hclog/stdlog.go @@ -1,18 +1,27 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( "bytes" "log" + "regexp" "strings" ) +// Regex to ignore characters commonly found in timestamp formats from the +// beginning of inputs. +var logTimestampRegexp = regexp.MustCompile(`^[\d\s\:\/\.\+-TZ]*`) + // Provides a io.Writer to shim the data out of *log.Logger // and back into our Logger. This is basically the only way to // build upon *log.Logger. type stdlogAdapter struct { - log Logger - inferLevels bool - forceLevel Level + log Logger + inferLevels bool + inferLevelsWithTimestamp bool + forceLevel Level } // Take the data, infer the levels if configured, and send it through @@ -28,6 +37,10 @@ func (s *stdlogAdapter) Write(data []byte) (int, error) { // Log at the forced level s.dispatch(str, s.forceLevel) } else if s.inferLevels { + if s.inferLevelsWithTimestamp { + str = s.trimTimestamp(str) + } + level, str := s.pickLevel(str) s.dispatch(str, level) } else { @@ -64,7 +77,7 @@ func (s *stdlogAdapter) pickLevel(str string) (Level, string) { case strings.HasPrefix(str, "[INFO]"): return Info, strings.TrimSpace(str[6:]) case strings.HasPrefix(str, "[WARN]"): - return Warn, strings.TrimSpace(str[7:]) + return Warn, strings.TrimSpace(str[6:]) case strings.HasPrefix(str, "[ERROR]"): return Error, strings.TrimSpace(str[7:]) case strings.HasPrefix(str, "[ERR]"): @@ -74,6 +87,11 @@ func (s *stdlogAdapter) pickLevel(str string) (Level, string) { } } +func (s *stdlogAdapter) trimTimestamp(str string) string { + idx := logTimestampRegexp.FindStringIndex(str) + return str[idx[1]:] +} + type logWriter struct { l *log.Logger } diff --git a/vendor/github.com/hashicorp/go-hclog/writer.go b/vendor/github.com/hashicorp/go-hclog/writer.go index 421a1f0..4ee219b 100644 --- a/vendor/github.com/hashicorp/go-hclog/writer.go +++ b/vendor/github.com/hashicorp/go-hclog/writer.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( diff --git a/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md b/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md index 6331af9..86c6d03 100644 --- a/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md +++ b/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md @@ -1,3 +1,5 @@ +# UNRELEASED + # 1.3.0 (September 17th, 2020) FEATURES diff --git a/vendor/github.com/hashicorp/go-immutable-radix/iter.go b/vendor/github.com/hashicorp/go-immutable-radix/iter.go index cd16d3b..f17d0a6 100644 --- a/vendor/github.com/hashicorp/go-immutable-radix/iter.go +++ b/vendor/github.com/hashicorp/go-immutable-radix/iter.go @@ -20,7 +20,7 @@ func (i *Iterator) SeekPrefixWatch(prefix []byte) (watch <-chan struct{}) { watch = n.mutateCh search := prefix for { - // Check for key exhaution + // Check for key exhaustion if len(search) == 0 { i.node = n return @@ -60,10 +60,13 @@ func (i *Iterator) recurseMin(n *Node) *Node { if n.leaf != nil { return n } - if len(n.edges) > 0 { + nEdges := len(n.edges) + if nEdges > 1 { // Add all the other edges to the stack (the min node will be added as // we recurse) i.stack = append(i.stack, n.edges[1:]) + } + if nEdges > 0 { return i.recurseMin(n.edges[0].node) } // Shouldn't be possible @@ -77,16 +80,32 @@ func (i *Iterator) recurseMin(n *Node) *Node { func (i *Iterator) SeekLowerBound(key []byte) { // Wipe the stack. Unlike Prefix iteration, we need to build the stack as we // go because we need only a subset of edges of many nodes in the path to the - // leaf with the lower bound. + // leaf with the lower bound. Note that the iterator will still recurse into + // children that we don't traverse on the way to the reverse lower bound as it + // walks the stack. i.stack = []edges{} + // i.node starts off in the common case as pointing to the root node of the + // tree. By the time we return we have either found a lower bound and setup + // the stack to traverse all larger keys, or we have not and the stack and + // node should both be nil to prevent the iterator from assuming it is just + // iterating the whole tree from the root node. Either way this needs to end + // up as nil so just set it here. n := i.node + i.node = nil search := key found := func(n *Node) { - i.node = n i.stack = append(i.stack, edges{edge{node: n}}) } + findMin := func(n *Node) { + n = i.recurseMin(n) + if n != nil { + found(n) + return + } + } + for { // Compare current prefix with the search key's same-length prefix. var prefixCmp int @@ -100,10 +119,7 @@ func (i *Iterator) SeekLowerBound(key []byte) { // Prefix is larger, that means the lower bound is greater than the search // and from now on we need to follow the minimum path to the smallest // leaf under this subtree. - n = i.recurseMin(n) - if n != nil { - found(n) - } + findMin(n) return } @@ -115,27 +131,29 @@ func (i *Iterator) SeekLowerBound(key []byte) { } // Prefix is equal, we are still heading for an exact match. If this is a - // leaf we're done. - if n.leaf != nil { - if bytes.Compare(n.leaf.key, key) < 0 { - i.node = nil - return - } + // leaf and an exact match we're done. + if n.leaf != nil && bytes.Equal(n.leaf.key, key) { found(n) return } - // Consume the search prefix - if len(n.prefix) > len(search) { - search = []byte{} - } else { - search = search[len(n.prefix):] + // Consume the search prefix if the current node has one. Note that this is + // safe because if n.prefix is longer than the search slice prefixCmp would + // have been > 0 above and the method would have already returned. + search = search[len(n.prefix):] + + if len(search) == 0 { + // We've exhausted the search key, but the current node is not an exact + // match or not a leaf. That means that the leaf value if it exists, and + // all child nodes must be strictly greater, the smallest key in this + // subtree must be the lower bound. + findMin(n) + return } // Otherwise, take the lower bound next edge. idx, lbNode := n.getLowerBoundEdge(search[0]) if lbNode == nil { - i.node = nil return } @@ -144,7 +162,6 @@ func (i *Iterator) SeekLowerBound(key []byte) { i.stack = append(i.stack, n.edges[idx+1:]) } - i.node = lbNode // Recurse n = lbNode } diff --git a/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go b/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go index 762471b..554fa71 100644 --- a/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go +++ b/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go @@ -8,6 +8,16 @@ import ( // in reverse in-order type ReverseIterator struct { i *Iterator + + // expandedParents stores the set of parent nodes whose relevant children have + // already been pushed into the stack. This can happen during seek or during + // iteration. + // + // Unlike forward iteration we need to recurse into children before we can + // output the value stored in an internal leaf since all children are greater. + // We use this to track whether we have already ensured all the children are + // in the stack. + expandedParents map[*Node]struct{} } // NewReverseIterator returns a new ReverseIterator at a node @@ -28,22 +38,6 @@ func (ri *ReverseIterator) SeekPrefix(prefix []byte) { ri.i.SeekPrefixWatch(prefix) } -func (ri *ReverseIterator) recurseMax(n *Node) *Node { - // Traverse to the maximum child - if n.leaf != nil { - return n - } - if len(n.edges) > 0 { - // Add all the other edges to the stack (the max node will be added as - // we recurse) - m := len(n.edges) - ri.i.stack = append(ri.i.stack, n.edges[:m-1]) - return ri.recurseMax(n.edges[m-1].node) - } - // Shouldn't be possible - return nil -} - // SeekReverseLowerBound is used to seek the iterator to the largest key that is // lower or equal to the given key. There is no watch variant as it's hard to // predict based on the radix structure which node(s) changes might affect the @@ -51,14 +45,32 @@ func (ri *ReverseIterator) recurseMax(n *Node) *Node { func (ri *ReverseIterator) SeekReverseLowerBound(key []byte) { // Wipe the stack. Unlike Prefix iteration, we need to build the stack as we // go because we need only a subset of edges of many nodes in the path to the - // leaf with the lower bound. + // leaf with the lower bound. Note that the iterator will still recurse into + // children that we don't traverse on the way to the reverse lower bound as it + // walks the stack. ri.i.stack = []edges{} + // ri.i.node starts off in the common case as pointing to the root node of the + // tree. By the time we return we have either found a lower bound and setup + // the stack to traverse all larger keys, or we have not and the stack and + // node should both be nil to prevent the iterator from assuming it is just + // iterating the whole tree from the root node. Either way this needs to end + // up as nil so just set it here. n := ri.i.node + ri.i.node = nil search := key + if ri.expandedParents == nil { + ri.expandedParents = make(map[*Node]struct{}) + } + found := func(n *Node) { - ri.i.node = n ri.i.stack = append(ri.i.stack, edges{edge{node: n}}) + // We need to mark this node as expanded in advance too otherwise the + // iterator will attempt to walk all of its children even though they are + // greater than the lower bound we have found. We've expanded it in the + // sense that all of its children that we want to walk are already in the + // stack (i.e. none of them). + ri.expandedParents[n] = struct{}{} } for { @@ -71,41 +83,73 @@ func (ri *ReverseIterator) SeekReverseLowerBound(key []byte) { } if prefixCmp < 0 { - // Prefix is smaller than search prefix, that means there is no lower bound. - // But we are looking in reverse, so the reverse lower bound will be the - // largest leaf under this subtree, since it is the value that would come - // right before the current search prefix if it were in the tree. So we need - // to follow the maximum path in this subtree to find it. - n = ri.recurseMax(n) - if n != nil { - found(n) - } + // Prefix is smaller than search prefix, that means there is no exact + // match for the search key. But we are looking in reverse, so the reverse + // lower bound will be the largest leaf under this subtree, since it is + // the value that would come right before the current search key if it + // were in the tree. So we need to follow the maximum path in this subtree + // to find it. Note that this is exactly what the iterator will already do + // if it finds a node in the stack that has _not_ been marked as expanded + // so in this one case we don't call `found` and instead let the iterator + // do the expansion and recursion through all the children. + ri.i.stack = append(ri.i.stack, edges{edge{node: n}}) return } if prefixCmp > 0 { - // Prefix is larger than search prefix, that means there is no reverse lower - // bound since nothing comes before our current search prefix. - ri.i.node = nil + // Prefix is larger than search prefix, or there is no prefix but we've + // also exhausted the search key. Either way, that means there is no + // reverse lower bound since nothing comes before our current search + // prefix. return } - // Prefix is equal, we are still heading for an exact match. If this is a - // leaf we're done. - if n.leaf != nil { - if bytes.Compare(n.leaf.key, key) < 0 { - ri.i.node = nil + // If this is a leaf, something needs to happen! Note that if it's a leaf + // and prefixCmp was zero (which it must be to get here) then the leaf value + // is either an exact match for the search, or it's lower. It can't be + // greater. + if n.isLeaf() { + + // Firstly, if it's an exact match, we're done! + if bytes.Equal(n.leaf.key, key) { + found(n) return } - found(n) - return + + // It's not so this node's leaf value must be lower and could still be a + // valid contender for reverse lower bound. + + // If it has no children then we are also done. + if len(n.edges) == 0 { + // This leaf is the lower bound. + found(n) + return + } + + // Finally, this leaf is internal (has children) so we'll keep searching, + // but we need to add it to the iterator's stack since it has a leaf value + // that needs to be iterated over. It needs to be added to the stack + // before its children below as it comes first. + ri.i.stack = append(ri.i.stack, edges{edge{node: n}}) + // We also need to mark it as expanded since we'll be adding any of its + // relevant children below and so don't want the iterator to re-add them + // on its way back up the stack. + ri.expandedParents[n] = struct{}{} } - // Consume the search prefix - if len(n.prefix) > len(search) { - search = []byte{} - } else { - search = search[len(n.prefix):] + // Consume the search prefix. Note that this is safe because if n.prefix is + // longer than the search slice prefixCmp would have been > 0 above and the + // method would have already returned. + search = search[len(n.prefix):] + + if len(search) == 0 { + // We've exhausted the search key but we are not at a leaf. That means all + // children are greater than the search key so a reverse lower bound + // doesn't exist in this subtree. Note that there might still be one in + // the whole radix tree by following a different path somewhere further + // up. If that's the case then the iterator's stack will contain all the + // smaller nodes already and Previous will walk through them correctly. + return } // Otherwise, take the lower bound next edge. @@ -125,14 +169,12 @@ func (ri *ReverseIterator) SeekReverseLowerBound(key []byte) { ri.i.stack = append(ri.i.stack, n.edges[:idx]) } - // Exit if there's not lower bound edge. The stack will have the - // previous nodes already. + // Exit if there's no lower bound edge. The stack will have the previous + // nodes already. if lbNode == nil { - ri.i.node = nil return } - ri.i.node = lbNode // Recurse n = lbNode } @@ -149,6 +191,10 @@ func (ri *ReverseIterator) Previous() ([]byte, interface{}, bool) { } } + if ri.expandedParents == nil { + ri.expandedParents = make(map[*Node]struct{}) + } + for len(ri.i.stack) > 0 { // Inspect the last element of the stack n := len(ri.i.stack) @@ -156,22 +202,38 @@ func (ri *ReverseIterator) Previous() ([]byte, interface{}, bool) { m := len(last) elem := last[m-1].node - // Update the stack + _, alreadyExpanded := ri.expandedParents[elem] + + // If this is an internal node and we've not seen it already, we need to + // leave it in the stack so we can return its possible leaf value _after_ + // we've recursed through all its children. + if len(elem.edges) > 0 && !alreadyExpanded { + // record that we've seen this node! + ri.expandedParents[elem] = struct{}{} + // push child edges onto stack and skip the rest of the loop to recurse + // into the largest one. + ri.i.stack = append(ri.i.stack, elem.edges) + continue + } + + // Remove the node from the stack if m > 1 { ri.i.stack[n-1] = last[:m-1] } else { ri.i.stack = ri.i.stack[:n-1] } - - // Push the edges onto the frontier - if len(elem.edges) > 0 { - ri.i.stack = append(ri.i.stack, elem.edges) + // We don't need this state any more as it's no longer in the stack so we + // won't visit it again + if alreadyExpanded { + delete(ri.expandedParents, elem) } - // Return the leaf values if any + // If this is a leaf, return it if elem.leaf != nil { return elem.leaf.key, elem.leaf.val, true } + + // it's not a leaf so keep walking the stack to find the previous leaf } return nil, nil, false } diff --git a/vendor/github.com/hashicorp/golang-lru/LICENSE b/vendor/github.com/hashicorp/golang-lru/LICENSE index be2cc4d..0e5d580 100644 --- a/vendor/github.com/hashicorp/golang-lru/LICENSE +++ b/vendor/github.com/hashicorp/golang-lru/LICENSE @@ -1,3 +1,5 @@ +Copyright (c) 2014 HashiCorp, Inc. + Mozilla Public License, version 2.0 1. Definitions diff --git a/vendor/github.com/hashicorp/golang-lru/simplelru/lru.go b/vendor/github.com/hashicorp/golang-lru/simplelru/lru.go index a86c853..9233583 100644 --- a/vendor/github.com/hashicorp/golang-lru/simplelru/lru.go +++ b/vendor/github.com/hashicorp/golang-lru/simplelru/lru.go @@ -25,7 +25,7 @@ type entry struct { // NewLRU constructs an LRU of the given size func NewLRU(size int, onEvict EvictCallback) (*LRU, error) { if size <= 0 { - return nil, errors.New("Must provide a positive size") + return nil, errors.New("must provide a positive size") } c := &LRU{ size: size, @@ -109,7 +109,7 @@ func (c *LRU) Remove(key interface{}) (present bool) { } // RemoveOldest removes the oldest item from the cache. -func (c *LRU) RemoveOldest() (key interface{}, value interface{}, ok bool) { +func (c *LRU) RemoveOldest() (key, value interface{}, ok bool) { ent := c.evictList.Back() if ent != nil { c.removeElement(ent) @@ -120,7 +120,7 @@ func (c *LRU) RemoveOldest() (key interface{}, value interface{}, ok bool) { } // GetOldest returns the oldest entry -func (c *LRU) GetOldest() (key interface{}, value interface{}, ok bool) { +func (c *LRU) GetOldest() (key, value interface{}, ok bool) { ent := c.evictList.Back() if ent != nil { kv := ent.Value.(*entry) diff --git a/vendor/github.com/hashicorp/golang-lru/simplelru/lru_interface.go b/vendor/github.com/hashicorp/golang-lru/simplelru/lru_interface.go index 92d7093..cb7f8ca 100644 --- a/vendor/github.com/hashicorp/golang-lru/simplelru/lru_interface.go +++ b/vendor/github.com/hashicorp/golang-lru/simplelru/lru_interface.go @@ -1,3 +1,4 @@ +// Package simplelru provides simple LRU implementation based on build-in container/list. package simplelru // LRUCache is the interface for simple LRU cache. @@ -34,6 +35,6 @@ type LRUCache interface { // Clears all cache entries. Purge() - // Resizes cache, returning number evicted - Resize(int) int + // Resizes cache, returning number evicted + Resize(int) int } diff --git a/vendor/github.com/mattn/go-colorable/.travis.yml b/vendor/github.com/mattn/go-colorable/.travis.yml deleted file mode 100644 index 7942c56..0000000 --- a/vendor/github.com/mattn/go-colorable/.travis.yml +++ /dev/null @@ -1,15 +0,0 @@ -language: go -sudo: false -go: - - 1.13.x - - tip - -before_install: - - go get -t -v ./... - -script: - - ./go.test.sh - -after_success: - - bash <(curl -s https://codecov.io/bash) - diff --git a/vendor/github.com/mattn/go-colorable/README.md b/vendor/github.com/mattn/go-colorable/README.md index e055952..ca04837 100644 --- a/vendor/github.com/mattn/go-colorable/README.md +++ b/vendor/github.com/mattn/go-colorable/README.md @@ -1,6 +1,6 @@ # go-colorable -[![Build Status](https://travis-ci.org/mattn/go-colorable.svg?branch=master)](https://travis-ci.org/mattn/go-colorable) +[![Build Status](https://github.com/mattn/go-colorable/workflows/test/badge.svg)](https://github.com/mattn/go-colorable/actions?query=workflow%3Atest) [![Codecov](https://codecov.io/gh/mattn/go-colorable/branch/master/graph/badge.svg)](https://codecov.io/gh/mattn/go-colorable) [![GoDoc](https://godoc.org/github.com/mattn/go-colorable?status.svg)](http://godoc.org/github.com/mattn/go-colorable) [![Go Report Card](https://goreportcard.com/badge/mattn/go-colorable)](https://goreportcard.com/report/mattn/go-colorable) diff --git a/vendor/github.com/mattn/go-colorable/colorable_appengine.go b/vendor/github.com/mattn/go-colorable/colorable_appengine.go index 1f7806f..416d1bb 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_appengine.go +++ b/vendor/github.com/mattn/go-colorable/colorable_appengine.go @@ -1,3 +1,4 @@ +//go:build appengine // +build appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_others.go b/vendor/github.com/mattn/go-colorable/colorable_others.go index 08cbd1e..766d946 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_others.go +++ b/vendor/github.com/mattn/go-colorable/colorable_others.go @@ -1,5 +1,5 @@ -// +build !windows -// +build !appengine +//go:build !windows && !appengine +// +build !windows,!appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_windows.go b/vendor/github.com/mattn/go-colorable/colorable_windows.go index b9e9363..1846ad5 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_windows.go +++ b/vendor/github.com/mattn/go-colorable/colorable_windows.go @@ -1,5 +1,5 @@ -// +build windows -// +build !appengine +//go:build windows && !appengine +// +build windows,!appengine package colorable @@ -10,6 +10,7 @@ import ( "os" "strconv" "strings" + "sync" "syscall" "unsafe" @@ -27,6 +28,7 @@ const ( backgroundRed = 0x40 backgroundIntensity = 0x80 backgroundMask = (backgroundRed | backgroundBlue | backgroundGreen | backgroundIntensity) + commonLvbUnderscore = 0x8000 cENABLE_VIRTUAL_TERMINAL_PROCESSING = 0x4 ) @@ -93,6 +95,7 @@ type Writer struct { oldattr word oldpos coord rest bytes.Buffer + mutex sync.Mutex } // NewColorable returns new instance of Writer which handles escape sequence from File. @@ -432,6 +435,8 @@ func atoiWithDefault(s string, def int) (int, error) { // Write writes data on console func (w *Writer) Write(data []byte) (n int, err error) { + w.mutex.Lock() + defer w.mutex.Unlock() var csbi consoleScreenBufferInfo procGetConsoleScreenBufferInfo.Call(uintptr(w.handle), uintptr(unsafe.Pointer(&csbi))) @@ -447,18 +452,22 @@ func (w *Writer) Write(data []byte) (n int, err error) { } else { er = bytes.NewReader(data) } - var bw [1]byte + var plaintext bytes.Buffer loop: for { c1, err := er.ReadByte() if err != nil { + plaintext.WriteTo(w.out) break loop } if c1 != 0x1b { - bw[0] = c1 - w.out.Write(bw[:]) + plaintext.WriteByte(c1) continue } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } c2, err := er.ReadByte() if err != nil { break loop @@ -683,14 +692,19 @@ loop: switch { case n == 0 || n == 100: attr = w.oldattr - case 1 <= n && n <= 5: - attr |= foregroundIntensity - case n == 7: - attr = ((attr & foregroundMask) << 4) | ((attr & backgroundMask) >> 4) - case n == 22 || n == 25: + case n == 4: + attr |= commonLvbUnderscore + case (1 <= n && n <= 3) || n == 5: attr |= foregroundIntensity - case n == 27: - attr = ((attr & foregroundMask) << 4) | ((attr & backgroundMask) >> 4) + case n == 7 || n == 27: + attr = + (attr &^ (foregroundMask | backgroundMask)) | + ((attr & foregroundMask) << 4) | + ((attr & backgroundMask) >> 4) + case n == 22: + attr &^= foregroundIntensity + case n == 24: + attr &^= commonLvbUnderscore case 30 <= n && n <= 37: attr &= backgroundMask if (n-30)&1 != 0 { @@ -709,7 +723,7 @@ loop: n256setup() } attr &= backgroundMask - attr |= n256foreAttr[n256] + attr |= n256foreAttr[n256%len(n256foreAttr)] i += 2 } } else if len(token) == 5 && token[i+1] == "2" { @@ -751,7 +765,7 @@ loop: n256setup() } attr &= foregroundMask - attr |= n256backAttr[n256] + attr |= n256backAttr[n256%len(n256backAttr)] i += 2 } } else if len(token) == 5 && token[i+1] == "2" { diff --git a/vendor/github.com/mattn/go-colorable/noncolorable.go b/vendor/github.com/mattn/go-colorable/noncolorable.go index 95f2c6b..05d6f74 100644 --- a/vendor/github.com/mattn/go-colorable/noncolorable.go +++ b/vendor/github.com/mattn/go-colorable/noncolorable.go @@ -18,18 +18,22 @@ func NewNonColorable(w io.Writer) io.Writer { // Write writes data on console func (w *NonColorable) Write(data []byte) (n int, err error) { er := bytes.NewReader(data) - var bw [1]byte + var plaintext bytes.Buffer loop: for { c1, err := er.ReadByte() if err != nil { + plaintext.WriteTo(w.out) break loop } if c1 != 0x1b { - bw[0] = c1 - w.out.Write(bw[:]) + plaintext.WriteByte(c1) continue } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } c2, err := er.ReadByte() if err != nil { break loop @@ -38,7 +42,6 @@ loop: continue } - var buf bytes.Buffer for { c, err := er.ReadByte() if err != nil { @@ -47,7 +50,6 @@ loop: if ('a' <= c && c <= 'z') || ('A' <= c && c <= 'Z') || c == '@' { break } - buf.Write([]byte(string(c))) } } diff --git a/vendor/github.com/mattn/go-isatty/.travis.yml b/vendor/github.com/mattn/go-isatty/.travis.yml deleted file mode 100644 index 604314d..0000000 --- a/vendor/github.com/mattn/go-isatty/.travis.yml +++ /dev/null @@ -1,14 +0,0 @@ -language: go -sudo: false -go: - - 1.13.x - - tip - -before_install: - - go get -t -v ./... - -script: - - ./go.test.sh - -after_success: - - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/github.com/mattn/go-isatty/isatty_bsd.go b/vendor/github.com/mattn/go-isatty/isatty_bsd.go index 711f288..d569c0c 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_bsd.go +++ b/vendor/github.com/mattn/go-isatty/isatty_bsd.go @@ -1,4 +1,5 @@ -// +build darwin freebsd openbsd netbsd dragonfly +//go:build (darwin || freebsd || openbsd || netbsd || dragonfly || hurd) && !appengine +// +build darwin freebsd openbsd netbsd dragonfly hurd // +build !appengine package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_others.go b/vendor/github.com/mattn/go-isatty/isatty_others.go index ff714a3..3150322 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_others.go +++ b/vendor/github.com/mattn/go-isatty/isatty_others.go @@ -1,4 +1,5 @@ -// +build appengine js nacl +//go:build appengine || js || nacl || wasm +// +build appengine js nacl wasm package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_plan9.go b/vendor/github.com/mattn/go-isatty/isatty_plan9.go index c5b6e0c..bae7f9b 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_plan9.go +++ b/vendor/github.com/mattn/go-isatty/isatty_plan9.go @@ -1,3 +1,4 @@ +//go:build plan9 // +build plan9 package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_solaris.go b/vendor/github.com/mattn/go-isatty/isatty_solaris.go index bdd5c79..0c3acf2 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_solaris.go +++ b/vendor/github.com/mattn/go-isatty/isatty_solaris.go @@ -1,5 +1,5 @@ -// +build solaris -// +build !appengine +//go:build solaris && !appengine +// +build solaris,!appengine package isatty @@ -8,10 +8,9 @@ import ( ) // IsTerminal returns true if the given file descriptor is a terminal. -// see: http://src.illumos.org/source/xref/illumos-gate/usr/src/lib/libbc/libc/gen/common/isatty.c +// see: https://src.illumos.org/source/xref/illumos-gate/usr/src/lib/libc/port/gen/isatty.c func IsTerminal(fd uintptr) bool { - var termio unix.Termio - err := unix.IoctlSetTermio(int(fd), unix.TCGETA, &termio) + _, err := unix.IoctlGetTermio(int(fd), unix.TCGETA) return err == nil } diff --git a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go index 31a1ca9..6778765 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go +++ b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go @@ -1,4 +1,5 @@ -// +build linux aix +//go:build (linux || aix || zos) && !appengine +// +build linux aix zos // +build !appengine package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_windows.go b/vendor/github.com/mattn/go-isatty/isatty_windows.go index 1fa8691..8e3c991 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_windows.go +++ b/vendor/github.com/mattn/go-isatty/isatty_windows.go @@ -1,5 +1,5 @@ -// +build windows -// +build !appengine +//go:build windows && !appengine +// +build windows,!appengine package isatty @@ -76,7 +76,7 @@ func isCygwinPipeName(name string) bool { } // getFileNameByHandle use the undocomented ntdll NtQueryObject to get file full name from file handler -// since GetFileInformationByHandleEx is not avilable under windows Vista and still some old fashion +// since GetFileInformationByHandleEx is not available under windows Vista and still some old fashion // guys are using Windows XP, this is a workaround for those guys, it will also work on system from // Windows vista to 10 // see https://stackoverflow.com/a/18792477 for details diff --git a/vendor/github.com/mattn/go-isatty/renovate.json b/vendor/github.com/mattn/go-isatty/renovate.json deleted file mode 100644 index 5ae9d96..0000000 --- a/vendor/github.com/mattn/go-isatty/renovate.json +++ /dev/null @@ -1,8 +0,0 @@ -{ - "extends": [ - "config:base" - ], - "postUpdateOptions": [ - "gomodTidy" - ] -} diff --git a/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md b/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md index 1955f28..c758234 100644 --- a/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md +++ b/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md @@ -1,6 +1,29 @@ -## unreleased +## 1.5.0 -* Fix regression where `*time.Time` value would be set to empty and not be sent +* New option `IgnoreUntaggedFields` to ignore decoding to any fields + without `mapstructure` (or the configured tag name) set [GH-277] +* New option `ErrorUnset` which makes it an error if any fields + in a target struct are not set by the decoding process. [GH-225] +* New function `OrComposeDecodeHookFunc` to help compose decode hooks. [GH-240] +* Decoding to slice from array no longer crashes [GH-265] +* Decode nested struct pointers to map [GH-271] +* Fix issue where `,squash` was ignored if `Squash` option was set. [GH-280] +* Fix issue where fields with `,omitempty` would sometimes decode + into a map with an empty string key [GH-281] + +## 1.4.3 + +* Fix cases where `json.Number` didn't decode properly [GH-261] + +## 1.4.2 + +* Custom name matchers to support any sort of casing, formatting, etc. for + field names. [GH-250] +* Fix possible panic in ComposeDecodeHookFunc [GH-251] + +## 1.4.1 + +* Fix regression where `*time.Time` value would be set to empty and not be sent to decode hooks properly [GH-232] ## 1.4.0 diff --git a/vendor/github.com/mitchellh/mapstructure/decode_hooks.go b/vendor/github.com/mitchellh/mapstructure/decode_hooks.go index 92e6f76..3a754ca 100644 --- a/vendor/github.com/mitchellh/mapstructure/decode_hooks.go +++ b/vendor/github.com/mitchellh/mapstructure/decode_hooks.go @@ -62,7 +62,8 @@ func DecodeHookExec( func ComposeDecodeHookFunc(fs ...DecodeHookFunc) DecodeHookFunc { return func(f reflect.Value, t reflect.Value) (interface{}, error) { var err error - var data interface{} + data := f.Interface() + newFrom := f for _, f1 := range fs { data, err = DecodeHookExec(f1, newFrom, t) @@ -76,6 +77,28 @@ func ComposeDecodeHookFunc(fs ...DecodeHookFunc) DecodeHookFunc { } } +// OrComposeDecodeHookFunc executes all input hook functions until one of them returns no error. In that case its value is returned. +// If all hooks return an error, OrComposeDecodeHookFunc returns an error concatenating all error messages. +func OrComposeDecodeHookFunc(ff ...DecodeHookFunc) DecodeHookFunc { + return func(a, b reflect.Value) (interface{}, error) { + var allErrs string + var out interface{} + var err error + + for _, f := range ff { + out, err = DecodeHookExec(f, a, b) + if err != nil { + allErrs += err.Error() + "\n" + continue + } + + return out, nil + } + + return nil, errors.New(allErrs) + } +} + // StringToSliceHookFunc returns a DecodeHookFunc that converts // string to []string by splitting on the given sep. func StringToSliceHookFunc(sep string) DecodeHookFunc { diff --git a/vendor/github.com/mitchellh/mapstructure/mapstructure.go b/vendor/github.com/mitchellh/mapstructure/mapstructure.go index 3643901..1efb22a 100644 --- a/vendor/github.com/mitchellh/mapstructure/mapstructure.go +++ b/vendor/github.com/mitchellh/mapstructure/mapstructure.go @@ -122,7 +122,7 @@ // field value is zero and a numeric type, the field is empty, and it won't // be encoded into the destination type. // -// type Source { +// type Source struct { // Age int `mapstructure:",omitempty"` // } // @@ -192,7 +192,7 @@ type DecodeHookFuncType func(reflect.Type, reflect.Type, interface{}) (interface // source and target types. type DecodeHookFuncKind func(reflect.Kind, reflect.Kind, interface{}) (interface{}, error) -// DecodeHookFuncRaw is a DecodeHookFunc which has complete access to both the source and target +// DecodeHookFuncValue is a DecodeHookFunc which has complete access to both the source and target // values. type DecodeHookFuncValue func(from reflect.Value, to reflect.Value) (interface{}, error) @@ -215,6 +215,12 @@ type DecoderConfig struct { // (extra keys). ErrorUnused bool + // If ErrorUnset is true, then it is an error for there to exist + // fields in the result that were not set in the decoding process + // (extra fields). This only applies to decoding to a struct. This + // will affect all nested structs as well. + ErrorUnset bool + // ZeroFields, if set to true, will zero fields before writing them. // For example, a map will be emptied before decoded values are put in // it. If this is false, a map will be merged. @@ -258,6 +264,15 @@ type DecoderConfig struct { // The tag name that mapstructure reads for field names. This // defaults to "mapstructure" TagName string + + // IgnoreUntaggedFields ignores all struct fields without explicit + // TagName, comparable to `mapstructure:"-"` as default behaviour. + IgnoreUntaggedFields bool + + // MatchName is the function used to match the map key to the struct + // field name or tag. Defaults to `strings.EqualFold`. This can be used + // to implement case-sensitive tag values, support snake casing, etc. + MatchName func(mapKey, fieldName string) bool } // A Decoder takes a raw interface value and turns it into structured @@ -279,6 +294,11 @@ type Metadata struct { // Unused is a slice of keys that were found in the raw value but // weren't decoded since there was no matching field in the result interface Unused []string + + // Unset is a slice of field names that were found in the result interface + // but weren't set in the decoding process since there was no matching value + // in the input + Unset []string } // Decode takes an input structure and uses reflection to translate it to @@ -370,12 +390,20 @@ func NewDecoder(config *DecoderConfig) (*Decoder, error) { if config.Metadata.Unused == nil { config.Metadata.Unused = make([]string, 0) } + + if config.Metadata.Unset == nil { + config.Metadata.Unset = make([]string, 0) + } } if config.TagName == "" { config.TagName = "mapstructure" } + if config.MatchName == nil { + config.MatchName = strings.EqualFold + } + result := &Decoder{ config: config, } @@ -675,16 +703,12 @@ func (d *Decoder) decodeUint(name string, data interface{}, val reflect.Value) e } case dataType.PkgPath() == "encoding/json" && dataType.Name() == "Number": jn := data.(json.Number) - i, err := jn.Int64() + i, err := strconv.ParseUint(string(jn), 0, 64) if err != nil { return fmt.Errorf( "error decoding json.Number into %s: %s", name, err) } - if i < 0 && !d.config.WeaklyTypedInput { - return fmt.Errorf("cannot parse '%s', %d overflows uint", - name, i) - } - val.SetUint(uint64(i)) + val.SetUint(i) default: return fmt.Errorf( "'%s' expected type '%s', got unconvertible type '%s', value: '%v'", @@ -901,9 +925,15 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re tagValue := f.Tag.Get(d.config.TagName) keyName := f.Name + if tagValue == "" && d.config.IgnoreUntaggedFields { + continue + } + // If Squash is set in the config, we squash the field down. squash := d.config.Squash && v.Kind() == reflect.Struct && f.Anonymous + v = dereferencePtrToStructIfNeeded(v, d.config.TagName) + // Determine the name of the key in the map if index := strings.Index(tagValue, ","); index != -1 { if tagValue[:index] == "-" { @@ -915,7 +945,7 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re } // If "squash" is specified in the tag, we squash the field down. - squash = !squash && strings.Index(tagValue[index+1:], "squash") != -1 + squash = squash || strings.Index(tagValue[index+1:], "squash") != -1 if squash { // When squashing, the embedded type can be a pointer to a struct. if v.Kind() == reflect.Ptr && v.Elem().Kind() == reflect.Struct { @@ -927,7 +957,9 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re return fmt.Errorf("cannot squash non-struct type '%s'", v.Type()) } } - keyName = tagValue[:index] + if keyNameTagValue := tagValue[:index]; keyNameTagValue != "" { + keyName = keyNameTagValue + } } else if len(tagValue) > 0 { if tagValue == "-" { continue @@ -1083,7 +1115,7 @@ func (d *Decoder) decodeSlice(name string, data interface{}, val reflect.Value) } // If the input value is nil, then don't allocate since empty != nil - if dataVal.IsNil() { + if dataValKind != reflect.Array && dataVal.IsNil() { return nil } @@ -1245,6 +1277,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e dataValKeysUnused[dataValKey.Interface()] = struct{}{} } + targetValKeysUnused := make(map[interface{}]struct{}) errors := make([]string, 0) // This slice will keep track of all the structs we'll be decoding. @@ -1340,7 +1373,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e continue } - if strings.EqualFold(mK, fieldName) { + if d.config.MatchName(mK, fieldName) { rawMapKey = dataValKey rawMapVal = dataVal.MapIndex(dataValKey) break @@ -1349,7 +1382,8 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e if !rawMapVal.IsValid() { // There was no matching key in the map for the value in - // the struct. Just ignore. + // the struct. Remember it for potential errors and metadata. + targetValKeysUnused[fieldName] = struct{}{} continue } } @@ -1409,6 +1443,17 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e errors = appendErrors(errors, err) } + if d.config.ErrorUnset && len(targetValKeysUnused) > 0 { + keys := make([]string, 0, len(targetValKeysUnused)) + for rawKey := range targetValKeysUnused { + keys = append(keys, rawKey.(string)) + } + sort.Strings(keys) + + err := fmt.Errorf("'%s' has unset fields: %s", name, strings.Join(keys, ", ")) + errors = appendErrors(errors, err) + } + if len(errors) > 0 { return &Error{errors} } @@ -1423,6 +1468,14 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e d.config.Metadata.Unused = append(d.config.Metadata.Unused, key) } + for rawKey := range targetValKeysUnused { + key := rawKey.(string) + if name != "" { + key = name + "." + key + } + + d.config.Metadata.Unset = append(d.config.Metadata.Unset, key) + } } return nil @@ -1460,3 +1513,28 @@ func getKind(val reflect.Value) reflect.Kind { return kind } } + +func isStructTypeConvertibleToMap(typ reflect.Type, checkMapstructureTags bool, tagName string) bool { + for i := 0; i < typ.NumField(); i++ { + f := typ.Field(i) + if f.PkgPath == "" && !checkMapstructureTags { // check for unexported fields + return true + } + if checkMapstructureTags && f.Tag.Get(tagName) != "" { // check for mapstructure tags inside + return true + } + } + return false +} + +func dereferencePtrToStructIfNeeded(v reflect.Value, tagName string) reflect.Value { + if v.Kind() != reflect.Ptr || v.Elem().Kind() != reflect.Struct { + return v + } + deref := v.Elem() + derefT := deref.Type() + if isStructTypeConvertibleToMap(derefT, true, tagName) { + return deref + } + return v +} diff --git a/vendor/github.com/onsi/gomega/.gitignore b/vendor/github.com/onsi/gomega/.gitignore index 720c13c..425d0a5 100644 --- a/vendor/github.com/onsi/gomega/.gitignore +++ b/vendor/github.com/onsi/gomega/.gitignore @@ -3,3 +3,5 @@ . .idea gomega.iml +TODO +.vscode \ No newline at end of file diff --git a/vendor/github.com/onsi/gomega/CHANGELOG.md b/vendor/github.com/onsi/gomega/CHANGELOG.md index 8c848ec..1526497 100644 --- a/vendor/github.com/onsi/gomega/CHANGELOG.md +++ b/vendor/github.com/onsi/gomega/CHANGELOG.md @@ -1,3 +1,187 @@ +## 1.27.10 + +### Fixes +- fix: go 1.21 adding goroutine ID to creator+location (#685) [bdc7803] + +## 1.27.9 + +### Fixes +- Prevent nil-dereference in format.Object for boxed nil error (#681) [3b31fc3] + +### Maintenance +- Bump golang.org/x/net from 0.11.0 to 0.12.0 (#679) [360849b] +- chore: use String() instead of fmt.Sprintf (#678) [86f3659] +- Bump golang.org/x/net from 0.10.0 to 0.11.0 (#674) [642ead0] +- chore: unnecessary use of fmt.Sprintf (#677) [ceb9ca6] +- Bump github.com/onsi/ginkgo/v2 from 2.10.0 to 2.11.0 (#675) [a2087d8] +- docs: fix ContainSubstring references (#673) [fc9a89f] +- Bump github.com/onsi/ginkgo/v2 from 2.9.7 to 2.10.0 (#671) [9076019] + +## 1.27.8 + +### Fixes +- HaveExactElement should not call FailureMessage if a submatcher returned an error [096f392] + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.9.5 to 2.9.7 (#669) [8884bee] + +## 1.27.7 + +### Fixes +- fix: gcustom.MakeMatcher accepts nil as actual value (#666) [57054d5] + +### Maintenance +- update gitignore [05c1bc6] +- Bump github.com/onsi/ginkgo/v2 from 2.9.4 to 2.9.5 (#663) [7cadcf6] +- Bump golang.org/x/net from 0.9.0 to 0.10.0 (#662) [b524839] +- Bump github.com/onsi/ginkgo/v2 from 2.9.2 to 2.9.4 (#661) [5f44694] +- Bump commonmarker from 0.23.8 to 0.23.9 in /docs (#657) [05dc99a] +- Bump nokogiri from 1.14.1 to 1.14.3 in /docs (#658) [3a033d1] +- Replace deprecated NewGomegaWithT with NewWithT (#659) [a19238f] +- Bump golang.org/x/net from 0.8.0 to 0.9.0 (#656) [29ed041] +- Bump actions/setup-go from 3 to 4 (#651) [11b2080] + +## 1.27.6 + +### Fixes +- Allow collections matchers to work correctly when expected has nil elements [60e7cf3] + +### Maintenance +- updates MatchError godoc comment to also accept a Gomega matcher (#654) [67b869d] + +## 1.27.5 + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.9.1 to 2.9.2 (#653) [a215021] +- Bump github.com/go-task/slim-sprig (#652) [a26fed8] + +## 1.27.4 + +### Fixes +- improve error formatting and remove duplication of error message in Eventually/Consistently [854f075] + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.9.0 to 2.9.1 (#650) [ccebd9b] + +## 1.27.3 + +### Fixes +- format.Object now always includes err.Error() when passed an error [86d97ef] +- Fix HaveExactElements to work inside ContainElement or other collection matchers (#648) [636757e] + +### Maintenance +- Bump github.com/golang/protobuf from 1.5.2 to 1.5.3 (#649) [cc16689] +- Bump github.com/onsi/ginkgo/v2 from 2.8.4 to 2.9.0 (#646) [e783366] + +## 1.27.2 + +### Fixes +- improve poll progress message when polling a consistently that has been passing [28a319b] + +### Maintenance +- bump ginkgo +- remove tools.go hack as Ginkgo 2.8.2 automatically pulls in the cli dependencies [81443b3] + +## 1.27.1 + +### Maintenance + +- Bump golang.org/x/net from 0.6.0 to 0.7.0 (#640) [bc686cd] + +## 1.27.0 + +### Features +- Add HaveExactElements matcher (#634) [9d50783] +- update Gomega docs to discuss GinkgoHelper() [be32774] + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.8.0 to 2.8.1 (#639) [296a68b] +- Bump golang.org/x/net from 0.5.0 to 0.6.0 (#638) [c2b098b] +- Bump github-pages from 227 to 228 in /docs (#636) [a9069ab] +- test: update matrix for Go 1.20 (#635) [6bd25c8] +- Bump github.com/onsi/ginkgo/v2 from 2.7.0 to 2.8.0 (#631) [5445f8b] +- Bump webrick from 1.7.0 to 1.8.1 in /docs (#630) [03e93bb] +- codeql: add ruby language (#626) [63c7d21] +- dependabot: add bundler package-ecosystem for docs (#625) [d92f963] + +## 1.26.0 + +### Features +- When a polled function returns an error, keep track of the actual and report on the matcher state of the last non-errored actual [21f3090] +- improve eventually failure message output [c530fb3] + +### Fixes +- fix several documentation spelling issues [e2eff1f] + + +## 1.25.0 + +### Features +- add `MustPassRepeatedly(int)` to asyncAssertion (#619) [4509f72] +- compare unwrapped errors using DeepEqual (#617) [aaeaa5d] + +### Maintenance +- Bump golang.org/x/net from 0.4.0 to 0.5.0 (#614) [c7cfea4] +- Bump github.com/onsi/ginkgo/v2 from 2.6.1 to 2.7.0 (#615) [71b8adb] +- Docs: Fix typo "MUltiple" -> "Multiple" (#616) [9351dda] +- clean up go.sum [cd1dc1d] + +## 1.24.2 + +### Fixes +- Correctly handle assertion failure panics for eventually/consistnetly "g Gomega"s in a goroutine [78f1660] +- docs:Fix typo "you an" -> "you can" (#607) [3187c1f] +- fixes issue #600 (#606) [808d192] + +### Maintenance +- Bump golang.org/x/net from 0.2.0 to 0.4.0 (#611) [6ebc0bf] +- Bump nokogiri from 1.13.9 to 1.13.10 in /docs (#612) [258cfc8] +- Bump github.com/onsi/ginkgo/v2 from 2.5.0 to 2.5.1 (#609) [e6c3eb9] + +## 1.24.1 + +### Fixes +- maintain backward compatibility for Eventually and Consisntetly's signatures [4c7df5e] +- fix small typo (#601) [ea0ebe6] + +### Maintenance +- Bump golang.org/x/net from 0.1.0 to 0.2.0 (#603) [1ba8372] +- Bump github.com/onsi/ginkgo/v2 from 2.4.0 to 2.5.0 (#602) [f9426cb] +- fix label-filter in test.yml [d795db6] +- stop running flakey tests and rely on external network dependencies in CI [7133290] + +## 1.24.0 + +### Features + +Introducting [gcustom](https://onsi.github.io/gomega/#gcustom-a-convenient-mechanism-for-buildling-custom-matchers) - a convenient mechanism for building custom matchers. + +This is an RC release for `gcustom`. The external API may be tweaked in response to feedback however it is expected to remain mostly stable. + +### Maintenance + +- Update BeComparableTo documentation [756eaa0] + +## 1.23.0 + +### Features +- Custom formatting on a per-type basis can be provided using `format.RegisterCustomFormatter()` -- see the docs [here](https://onsi.github.io/gomega/#adjusting-output) + +- Substantial improvement have been made to `StopTrying()`: + - Users can now use `StopTrying().Wrap(err)` to wrap errors and `StopTrying().Attach(description, object)` to attach arbitrary objects to the `StopTrying()` error + - `StopTrying()` is now always interpreted as a failure. If you are an early adopter of `StopTrying()` you may need to change your code as the prior version would match against the returned value even if `StopTrying()` was returned. Going forward the `StopTrying()` api should remain stable. + - `StopTrying()` and `StopTrying().Now()` can both be used in matchers - not just polled functions. + +- `TryAgainAfter(duration)` is used like `StopTrying()` but instructs `Eventually` and `Consistently` that the poll should be tried again after the specified duration. This allows you to dynamically adjust the polling duration. + +- `ctx` can now be passed-in as the first argument to `Eventually` and `Consistently`. + +## Maintenance + +- Bump github.com/onsi/ginkgo/v2 from 2.3.0 to 2.3.1 (#597) [afed901] +- Bump nokogiri from 1.13.8 to 1.13.9 in /docs (#599) [7c691b3] +- Bump github.com/google/go-cmp from 0.5.8 to 0.5.9 (#587) [ff22665] + ## 1.22.1 ## Fixes diff --git a/vendor/github.com/onsi/gomega/RELEASING.md b/vendor/github.com/onsi/gomega/RELEASING.md index 7153b9b..9973fff 100644 --- a/vendor/github.com/onsi/gomega/RELEASING.md +++ b/vendor/github.com/onsi/gomega/RELEASING.md @@ -5,7 +5,7 @@ A Gomega release is a tagged sha and a GitHub release. To cut a release: ```bash LAST_VERSION=$(git tag --sort=version:refname | tail -n1) CHANGES=$(git log --pretty=format:'- %s [%h]' HEAD...$LAST_VERSION) - echo -e "## NEXT\n\n$CHANGES\n\n### Features\n\n## Fixes\n\n## Maintenance\n\n$(cat CHANGELOG.md)" > CHANGELOG.md + echo -e "## NEXT\n\n$CHANGES\n\n### Features\n\n### Fixes\n\n### Maintenance\n\n$(cat CHANGELOG.md)" > CHANGELOG.md ``` to update the changelog - Categorize the changes into diff --git a/vendor/github.com/onsi/gomega/format/format.go b/vendor/github.com/onsi/gomega/format/format.go index 6e78c39..6c16806 100644 --- a/vendor/github.com/onsi/gomega/format/format.go +++ b/vendor/github.com/onsi/gomega/format/format.go @@ -52,7 +52,7 @@ var CharactersAroundMismatchToInclude uint = 5 var contextType = reflect.TypeOf((*context.Context)(nil)).Elem() var timeType = reflect.TypeOf(time.Time{}) -//The default indentation string emitted by the format package +// The default indentation string emitted by the format package var Indent = " " var longFormThreshold = 20 @@ -65,6 +65,52 @@ type GomegaStringer interface { GomegaString() string } +/* +CustomFormatters can be registered with Gomega via RegisterCustomFormatter() +Any value to be rendered by Gomega is passed to each registered CustomFormatters. +The CustomFormatter signals that it will handle formatting the value by returning (formatted-string, true) +If the CustomFormatter does not want to handle the object it should return ("", false) + +Strings returned by CustomFormatters are not truncated +*/ +type CustomFormatter func(value interface{}) (string, bool) +type CustomFormatterKey uint + +var customFormatterKey CustomFormatterKey = 1 + +type customFormatterKeyPair struct { + CustomFormatter + CustomFormatterKey +} + +/* +RegisterCustomFormatter registers a CustomFormatter and returns a CustomFormatterKey + +You can call UnregisterCustomFormatter with the returned key to unregister the associated CustomFormatter +*/ +func RegisterCustomFormatter(customFormatter CustomFormatter) CustomFormatterKey { + key := customFormatterKey + customFormatterKey += 1 + customFormatters = append(customFormatters, customFormatterKeyPair{customFormatter, key}) + return key +} + +/* +UnregisterCustomFormatter unregisters a previously registered CustomFormatter. You should pass in the key returned by RegisterCustomFormatter +*/ +func UnregisterCustomFormatter(key CustomFormatterKey) { + formatters := []customFormatterKeyPair{} + for _, f := range customFormatters { + if f.CustomFormatterKey == key { + continue + } + formatters = append(formatters, f) + } + customFormatters = formatters +} + +var customFormatters = []customFormatterKeyPair{} + /* Generates a formatted matcher success/failure message of the form: @@ -212,24 +258,35 @@ Set PrintContextObjects to true to print the content of objects implementing con func Object(object interface{}, indentation uint) string { indent := strings.Repeat(Indent, int(indentation)) value := reflect.ValueOf(object) - return fmt.Sprintf("%s<%s>: %s", indent, formatType(value), formatValue(value, indentation)) + commonRepresentation := "" + if err, ok := object.(error); ok && !isNilValue(value) { // isNilValue check needed here to avoid nil deref due to boxed nil + commonRepresentation += "\n" + IndentString(err.Error(), indentation) + "\n" + indent + } + return fmt.Sprintf("%s<%s>: %s%s", indent, formatType(value), commonRepresentation, formatValue(value, indentation)) } /* IndentString takes a string and indents each line by the specified amount. */ func IndentString(s string, indentation uint) string { + return indentString(s, indentation, true) +} + +func indentString(s string, indentation uint, indentFirstLine bool) string { + result := &strings.Builder{} components := strings.Split(s, "\n") - result := "" indent := strings.Repeat(Indent, int(indentation)) for i, component := range components { - result += indent + component + if i > 0 || indentFirstLine { + result.WriteString(indent) + } + result.WriteString(component) if i < len(components)-1 { - result += "\n" + result.WriteString("\n") } } - return result + return result.String() } func formatType(v reflect.Value) string { @@ -245,7 +302,7 @@ func formatType(v reflect.Value) string { case reflect.Map: return fmt.Sprintf("%s | len:%d", v.Type(), v.Len()) default: - return fmt.Sprintf("%s", v.Type()) + return v.Type().String() } } @@ -261,18 +318,27 @@ func formatValue(value reflect.Value, indentation uint) string { if value.CanInterface() { obj := value.Interface() + // if a CustomFormatter handles this values, we'll go with that + for _, customFormatter := range customFormatters { + formatted, handled := customFormatter.CustomFormatter(obj) + // do not truncate a user-provided CustomFormatter() + if handled { + return indentString(formatted, indentation+1, false) + } + } + // GomegaStringer will take precedence to other representations and disregards UseStringerRepresentation if x, ok := obj.(GomegaStringer); ok { - // do not truncate a user-defined GoMegaString() value - return x.GomegaString() + // do not truncate a user-defined GomegaString() value + return indentString(x.GomegaString(), indentation+1, false) } if UseStringerRepresentation { switch x := obj.(type) { case fmt.GoStringer: - return truncateLongStrings(x.GoString()) + return indentString(truncateLongStrings(x.GoString()), indentation+1, false) case fmt.Stringer: - return truncateLongStrings(x.String()) + return indentString(truncateLongStrings(x.String()), indentation+1, false) } } } diff --git a/vendor/github.com/onsi/gomega/gomega_dsl.go b/vendor/github.com/onsi/gomega/gomega_dsl.go index 6a9d80b..1fd1803 100644 --- a/vendor/github.com/onsi/gomega/gomega_dsl.go +++ b/vendor/github.com/onsi/gomega/gomega_dsl.go @@ -22,7 +22,7 @@ import ( "github.com/onsi/gomega/types" ) -const GOMEGA_VERSION = "1.22.1" +const GOMEGA_VERSION = "1.27.10" const nilGomegaPanic = `You are trying to make an assertion, but haven't registered Gomega's fail handler. If you're using Ginkgo then you probably forgot to put your assertion in an It(). @@ -86,12 +86,12 @@ func internalGomega(g Gomega) *internal.Gomega { // NewWithT takes a *testing.T and returns a `gomega.WithT` allowing you to use `Expect`, `Eventually`, and `Consistently` along with // Gomega's rich ecosystem of matchers in standard `testing` test suits. // -// func TestFarmHasCow(t *testing.T) { -// g := gomega.NewWithT(t) +// func TestFarmHasCow(t *testing.T) { +// g := gomega.NewWithT(t) // -// f := farm.New([]string{"Cow", "Horse"}) -// g.Expect(f.HasCow()).To(BeTrue(), "Farm should have cow") -// } +// f := farm.New([]string{"Cow", "Horse"}) +// g.Expect(f.HasCow()).To(BeTrue(), "Farm should have cow") +// } func NewWithT(t types.GomegaTestingT) *WithT { return internal.NewGomega(internalGomega(Default).DurationBundle).ConfigureWithT(t) } @@ -171,7 +171,8 @@ func ensureDefaultGomegaIsConfigured() { } // Ω wraps an actual value allowing assertions to be made on it: -// Ω("foo").Should(Equal("foo")) +// +// Ω("foo").Should(Equal("foo")) // // If Ω is passed more than one argument it will pass the *first* argument to the matcher. // All subsequent arguments will be required to be nil/zero. @@ -180,10 +181,13 @@ func ensureDefaultGomegaIsConfigured() { // a value and an error - a common patter in Go. // // For example, given a function with signature: -// func MyAmazingThing() (int, error) +// +// func MyAmazingThing() (int, error) // // Then: -// Ω(MyAmazingThing()).Should(Equal(3)) +// +// Ω(MyAmazingThing()).Should(Equal(3)) +// // Will succeed only if `MyAmazingThing()` returns `(3, nil)` // // Ω and Expect are identical @@ -193,19 +197,23 @@ func Ω(actual interface{}, extra ...interface{}) Assertion { } // Expect wraps an actual value allowing assertions to be made on it: -// Expect("foo").To(Equal("foo")) +// +// Expect("foo").To(Equal("foo")) // // If Expect is passed more than one argument it will pass the *first* argument to the matcher. // All subsequent arguments will be required to be nil/zero. // // This is convenient if you want to make an assertion on a method/function that returns -// a value and an error - a common patter in Go. +// a value and an error - a common pattern in Go. // // For example, given a function with signature: -// func MyAmazingThing() (int, error) +// +// func MyAmazingThing() (int, error) // // Then: -// Expect(MyAmazingThing()).Should(Equal(3)) +// +// Expect(MyAmazingThing()).Should(Equal(3)) +// // Will succeed only if `MyAmazingThing()` returns `(3, nil)` // // Expect and Ω are identical @@ -215,7 +223,8 @@ func Expect(actual interface{}, extra ...interface{}) Assertion { } // ExpectWithOffset wraps an actual value allowing assertions to be made on it: -// ExpectWithOffset(1, "foo").To(Equal("foo")) +// +// ExpectWithOffset(1, "foo").To(Equal("foo")) // // Unlike `Expect` and `Ω`, `ExpectWithOffset` takes an additional integer argument // that is used to modify the call-stack offset when computing line numbers. It is @@ -241,15 +250,15 @@ Eventually works with any Gomega compatible matcher and supports making assertio There are several examples of values that can change over time. These can be passed in to Eventually and will be passed to the matcher repeatedly until a match occurs. For example: - c := make(chan bool) - go DoStuff(c) - Eventually(c, "50ms").Should(BeClosed()) + c := make(chan bool) + go DoStuff(c) + Eventually(c, "50ms").Should(BeClosed()) will poll the channel repeatedly until it is closed. In this example `Eventually` will block until either the specified timeout of 50ms has elapsed or the channel is closed, whichever comes first. Several Gomega libraries allow you to use Eventually in this way. For example, the gomega/gexec package allows you to block until a *gexec.Session exits successfully via: - Eventually(session).Should(gexec.Exit(0)) + Eventually(session).Should(gexec.Exit(0)) And the gomega/gbytes package allows you to monitor a streaming *gbytes.Buffer until a given string is seen: @@ -270,34 +279,38 @@ Eventually can be passed functions that **return at least one value**. When con For example: - Eventually(func() int { - return client.FetchCount() - }).Should(BeNumerically(">=", 17)) + Eventually(func() int { + return client.FetchCount() + }).Should(BeNumerically(">=", 17)) - will repeatedly poll client.FetchCount until the BeNumerically matcher is satisfied. (Note that this example could have been written as Eventually(client.FetchCount).Should(BeNumerically(">=", 17))) + will repeatedly poll client.FetchCount until the BeNumerically matcher is satisfied. (Note that this example could have been written as Eventually(client.FetchCount).Should(BeNumerically(">=", 17))) If multiple values are returned by the function, Eventually will pass the first value to the matcher and require that all others are zero-valued. This allows you to pass Eventually a function that returns a value and an error - a common pattern in Go. For example, consider a method that returns a value and an error: - func FetchFromDB() (string, error) + + func FetchFromDB() (string, error) Then - Eventually(FetchFromDB).Should(Equal("got it")) + + Eventually(FetchFromDB).Should(Equal("got it")) will pass only if and when the returned error is nil *and* the returned string satisfies the matcher. Eventually can also accept functions that take arguments, however you must provide those arguments using .WithArguments(). For example, consider a function that takes a user-id and makes a network request to fetch a full name: + func FetchFullName(userId int) (string, error) You can poll this function like so: + Eventually(FetchFullName).WithArguments(1138).Should(Equal("Wookie")) It is important to note that the function passed into Eventually is invoked *synchronously* when polled. Eventually does not (in fact, it cannot) kill the function if it takes longer to return than Eventually's configured timeout. A common practice here is to use a context. Here's an example that combines Ginkgo's spec timeout support with Eventually: It("fetches the correct count", func(ctx SpecContext) { - Eventually(func() int { + Eventually(ctx, func() int { return client.FetchCount(ctx, "/users") - }, ctx).Should(BeNumerically(">=", 17)) + }).Should(BeNumerically(">=", 17)) }, SpecTimeout(time.Second)) you an also use Eventually().WithContext(ctx) to pass in the context. Passed-in contexts play nicely with paseed-in arguments as long as the context appears first. You can rewrite the above example as: @@ -326,13 +339,13 @@ will pass only if all the assertions in the polled function pass and the return Eventually also supports a special case polling function that takes a single Gomega argument and returns no values. Eventually assumes such a function is making assertions and is designed to work with the Succeed matcher to validate that all assertions have passed. For example: - Eventually(func(g Gomega) { - model, err := client.Find(1138) - g.Expect(err).NotTo(HaveOccurred()) - g.Expect(model.Reticulate()).To(Succeed()) - g.Expect(model.IsReticulated()).To(BeTrue()) - g.Expect(model.Save()).To(Succeed()) - }).Should(Succeed()) + Eventually(func(g Gomega) { + model, err := client.Find(1138) + g.Expect(err).NotTo(HaveOccurred()) + g.Expect(model.Reticulate()).To(Succeed()) + g.Expect(model.IsReticulated()).To(BeTrue()) + g.Expect(model.Save()).To(Succeed()) + }).Should(Succeed()) will rerun the function until all assertions pass. @@ -347,17 +360,27 @@ You can also pass additional arugments to functions that take a Gomega. The onl g.Expect(elements).To(ConsistOf(expected)) }).WithContext(ctx).WithArguments("/names", "Joe", "Jane", "Sam").Should(Succeed()) +You can ensure that you get a number of consecutive successful tries before succeeding using `MustPassRepeatedly(int)`. For Example: + + int count := 0 + Eventually(func() bool { + count++ + return count > 2 + }).MustPassRepeatedly(2).Should(BeTrue()) + // Because we had to wait for 2 calls that returned true + Expect(count).To(Equal(3)) + Finally, in addition to passing timeouts and a context to Eventually you can be more explicit with Eventually's chaining configuration methods: Eventually(..., "1s", "2s", ctx).Should(...) is equivalent to - Eventually(...).WithTimeout(time.Second).WithPolling(2*time.Second).WithContext(ctx).Should(...) + Eventually(...).WithTimeout(time.Second).WithPolling(2*time.Second).WithContext(ctx).Should(...) */ -func Eventually(actual interface{}, args ...interface{}) AsyncAssertion { +func Eventually(actualOrCtx interface{}, args ...interface{}) AsyncAssertion { ensureDefaultGomegaIsConfigured() - return Default.Eventually(actual, args...) + return Default.Eventually(actualOrCtx, args...) } // EventuallyWithOffset operates like Eventually but takes an additional @@ -369,9 +392,9 @@ func Eventually(actual interface{}, args ...interface{}) AsyncAssertion { // `EventuallyWithOffset` specifying a timeout interval (and an optional polling interval) are // the same as `Eventually(...).WithOffset(...).WithTimeout` or // `Eventually(...).WithOffset(...).WithTimeout(...).WithPolling`. -func EventuallyWithOffset(offset int, actual interface{}, args ...interface{}) AsyncAssertion { +func EventuallyWithOffset(offset int, actualOrCtx interface{}, args ...interface{}) AsyncAssertion { ensureDefaultGomegaIsConfigured() - return Default.EventuallyWithOffset(offset, actual, args...) + return Default.EventuallyWithOffset(offset, actualOrCtx, args...) } /* @@ -385,13 +408,13 @@ Consistently accepts the same three categories of actual as Eventually, check th Consistently is useful in cases where you want to assert that something *does not happen* for a period of time. For example, you may want to assert that a goroutine does *not* send data down a channel. In this case you could write: - Consistently(channel, "200ms").ShouldNot(Receive()) + Consistently(channel, "200ms").ShouldNot(Receive()) This will block for 200 milliseconds and repeatedly check the channel and ensure nothing has been received. */ -func Consistently(actual interface{}, args ...interface{}) AsyncAssertion { +func Consistently(actualOrCtx interface{}, args ...interface{}) AsyncAssertion { ensureDefaultGomegaIsConfigured() - return Default.Consistently(actual, args...) + return Default.Consistently(actualOrCtx, args...) } // ConsistentlyWithOffset operates like Consistently but takes an additional @@ -400,44 +423,54 @@ func Consistently(actual interface{}, args ...interface{}) AsyncAssertion { // // `ConsistentlyWithOffset` is the same as `Consistently(...).WithOffset` and // optional `WithTimeout` and `WithPolling`. -func ConsistentlyWithOffset(offset int, actual interface{}, args ...interface{}) AsyncAssertion { +func ConsistentlyWithOffset(offset int, actualOrCtx interface{}, args ...interface{}) AsyncAssertion { ensureDefaultGomegaIsConfigured() - return Default.ConsistentlyWithOffset(offset, actual, args...) + return Default.ConsistentlyWithOffset(offset, actualOrCtx, args...) } /* -StopTrying can be used to signal to Eventually and Consistently that the polled function will not change -and that they should stop trying. In the case of Eventually, if a match does not occur in this, final, iteration then a failure will result. In the case of Consistently, as long as this last iteration satisfies the match, the assertion will be considered successful. +StopTrying can be used to signal to Eventually and Consistentlythat they should abort and stop trying. This always results in a failure of the assertion - and the failure message is the content of the StopTrying signal. + +You can send the StopTrying signal by either returning StopTrying("message") as an error from your passed-in function _or_ by calling StopTrying("message").Now() to trigger a panic and end execution. -You can send the StopTrying signal by either returning a StopTrying("message") messages as an error from your passed-in function _or_ by calling StopTrying("message").Now() to trigger a panic and end execution. +You can also wrap StopTrying around an error with `StopTrying("message").Wrap(err)` and can attach additional objects via `StopTrying("message").Attach("description", object). When rendered, the signal will include the wrapped error and any attached objects rendered using Gomega's default formatting. Here are a couple of examples. This is how you might use StopTrying() as an error to signal that Eventually should stop: playerIndex, numPlayers := 0, 11 Eventually(func() (string, error) { - name := client.FetchPlayer(playerIndex) - playerIndex += 1 - if playerIndex == numPlayers { - return name, StopTrying("No more players left") - } else { - return name, nil - } + if playerIndex == numPlayers { + return "", StopTrying("no more players left") + } + name := client.FetchPlayer(playerIndex) + playerIndex += 1 + return name, nil }).Should(Equal("Patrick Mahomes")) -note that the final `name` returned alongside `StopTrying()` will be processed. - And here's an example where `StopTrying().Now()` is called to halt execution immediately: Eventually(func() []string { names, err := client.FetchAllPlayers() if err == client.IRRECOVERABLE_ERROR { - StopTrying("Irrecoverable error occurred").Now() + StopTrying("Irrecoverable error occurred").Wrap(err).Now() } return names }).Should(ContainElement("Patrick Mahomes")) */ var StopTrying = internal.StopTrying +/* +TryAgainAfter() allows you to adjust the polling interval for the _next_ iteration of `Eventually` or `Consistently`. Like `StopTrying` you can either return `TryAgainAfter` as an error or trigger it immedieately with `.Now()` + +When `TryAgainAfter(` is triggered `Eventually` and `Consistently` will wait for that duration. If a timeout occurs before the next poll is triggered both `Eventually` and `Consistently` will always fail with the content of the TryAgainAfter message. As with StopTrying you can `.Wrap()` and error and `.Attach()` additional objects to `TryAgainAfter`. +*/ +var TryAgainAfter = internal.TryAgainAfter + +/* +PollingSignalError is the error returned by StopTrying() and TryAgainAfter() +*/ +type PollingSignalError = internal.PollingSignalError + // SetDefaultEventuallyTimeout sets the default timeout duration for Eventually. Eventually will repeatedly poll your condition until it succeeds, or until this timeout elapses. func SetDefaultEventuallyTimeout(t time.Duration) { Default.SetDefaultEventuallyTimeout(t) @@ -471,8 +504,8 @@ func SetDefaultConsistentlyPollingInterval(t time.Duration) { // // Example: // -// Eventually(myChannel).Should(Receive(), "Something should have come down the pipe.") -// Consistently(myChannel).ShouldNot(Receive(), func() string { return "Nothing should have come down the pipe." }) +// Eventually(myChannel).Should(Receive(), "Something should have come down the pipe.") +// Consistently(myChannel).ShouldNot(Receive(), func() string { return "Nothing should have come down the pipe." }) type AsyncAssertion = types.AsyncAssertion // GomegaAsyncAssertion is deprecated in favor of AsyncAssertion, which does not stutter. @@ -494,7 +527,7 @@ type GomegaAsyncAssertion = types.AsyncAssertion // // Example: // -// Ω(farm.HasCow()).Should(BeTrue(), "Farm %v should have a cow", farm) +// Ω(farm.HasCow()).Should(BeTrue(), "Farm %v should have a cow", farm) type Assertion = types.Assertion // GomegaAssertion is deprecated in favor of Assertion, which does not stutter. diff --git a/vendor/github.com/onsi/gomega/internal/assertion.go b/vendor/github.com/onsi/gomega/internal/assertion.go index 7b7bdd1..08356a6 100644 --- a/vendor/github.com/onsi/gomega/internal/assertion.go +++ b/vendor/github.com/onsi/gomega/internal/assertion.go @@ -4,6 +4,7 @@ import ( "fmt" "reflect" + "github.com/onsi/gomega/format" "github.com/onsi/gomega/types" ) @@ -146,7 +147,12 @@ func vetActuals(actuals []interface{}, skipIndex int) (bool, string) { if actual != nil { zeroValue := reflect.Zero(reflect.TypeOf(actual)).Interface() if !reflect.DeepEqual(zeroValue, actual) { - message := fmt.Sprintf("Unexpected non-nil/non-zero argument at index %d:\n\t<%T>: %#v", i, actual, actual) + var message string + if err, ok := actual.(error); ok { + message = fmt.Sprintf("Unexpected error: %s\n%s", err, format.Object(err, 1)) + } else { + message = fmt.Sprintf("Unexpected non-nil/non-zero argument at index %d:\n\t<%T>: %#v", i, actual, actual) + } return false, message } } diff --git a/vendor/github.com/onsi/gomega/internal/async_assertion.go b/vendor/github.com/onsi/gomega/internal/async_assertion.go index 818a6e1..1188b0b 100644 --- a/vendor/github.com/onsi/gomega/internal/async_assertion.go +++ b/vendor/github.com/onsi/gomega/internal/async_assertion.go @@ -9,51 +9,43 @@ import ( "sync" "time" + "github.com/onsi/gomega/format" "github.com/onsi/gomega/types" ) -type StopTryingError interface { - error - Now() - wasViaPanic() bool -} - -func asStopTryingError(actual interface{}) (StopTryingError, bool) { - if actual == nil { - return nil, false - } - if actualErr, ok := actual.(error); ok { - var target *stopTryingError - if errors.As(actualErr, &target) { - return target, true - } else { - return nil, false - } - } +var errInterface = reflect.TypeOf((*error)(nil)).Elem() +var gomegaType = reflect.TypeOf((*types.Gomega)(nil)).Elem() +var contextType = reflect.TypeOf(new(context.Context)).Elem() - return nil, false +type formattedGomegaError interface { + FormattedGomegaError() string } -type stopTryingError struct { - message string - viaPanic bool +type asyncPolledActualError struct { + message string } -func (s *stopTryingError) Error() string { - return s.message +func (err *asyncPolledActualError) Error() string { + return err.message } -func (s *stopTryingError) Now() { - s.viaPanic = true - panic(s) +func (err *asyncPolledActualError) FormattedGomegaError() string { + return err.message } -func (s *stopTryingError) wasViaPanic() bool { - return s.viaPanic +type contextWithAttachProgressReporter interface { + AttachProgressReporter(func() string) func() } -var StopTrying = func(message string) StopTryingError { - return &stopTryingError{message: message} +type asyncGomegaHaltExecutionError struct{} + +func (a asyncGomegaHaltExecutionError) GinkgoRecoverShouldIgnoreThisPanic() {} +func (a asyncGomegaHaltExecutionError) Error() string { + return `An assertion has failed in a goroutine. You should call + + defer GinkgoRecover() + +at the top of the goroutine that caused this panic. This will allow Ginkgo and Gomega to correctly capture and manage this panic.` } type AsyncAssertionType uint @@ -80,21 +72,23 @@ type AsyncAssertion struct { actual interface{} argsToForward []interface{} - timeoutInterval time.Duration - pollingInterval time.Duration - ctx context.Context - offset int - g *Gomega + timeoutInterval time.Duration + pollingInterval time.Duration + mustPassRepeatedly int + ctx context.Context + offset int + g *Gomega } -func NewAsyncAssertion(asyncType AsyncAssertionType, actualInput interface{}, g *Gomega, timeoutInterval time.Duration, pollingInterval time.Duration, ctx context.Context, offset int) *AsyncAssertion { +func NewAsyncAssertion(asyncType AsyncAssertionType, actualInput interface{}, g *Gomega, timeoutInterval time.Duration, pollingInterval time.Duration, mustPassRepeatedly int, ctx context.Context, offset int) *AsyncAssertion { out := &AsyncAssertion{ - asyncType: asyncType, - timeoutInterval: timeoutInterval, - pollingInterval: pollingInterval, - offset: offset, - ctx: ctx, - g: g, + asyncType: asyncType, + timeoutInterval: timeoutInterval, + pollingInterval: pollingInterval, + mustPassRepeatedly: mustPassRepeatedly, + offset: offset, + ctx: ctx, + g: g, } out.actual = actualInput @@ -140,6 +134,11 @@ func (assertion *AsyncAssertion) WithArguments(argsToForward ...interface{}) typ return assertion } +func (assertion *AsyncAssertion) MustPassRepeatedly(count int) types.AsyncAssertion { + assertion.mustPassRepeatedly = count + return assertion +} + func (assertion *AsyncAssertion) Should(matcher types.GomegaMatcher, optionalDescription ...interface{}) bool { assertion.g.THelper() vetOptionalDescription("Asynchronous assertion", optionalDescription...) @@ -164,39 +163,44 @@ func (assertion *AsyncAssertion) buildDescription(optionalDescription ...interfa return fmt.Sprintf(optionalDescription[0].(string), optionalDescription[1:]...) + "\n" } -func (assertion *AsyncAssertion) processReturnValues(values []reflect.Value) (interface{}, error, StopTryingError) { - var err error - var stopTrying StopTryingError - +func (assertion *AsyncAssertion) processReturnValues(values []reflect.Value) (interface{}, error) { if len(values) == 0 { - return nil, fmt.Errorf("No values were returned by the function passed to Gomega"), stopTrying + return nil, &asyncPolledActualError{ + message: fmt.Sprintf("The function passed to %s did not return any values", assertion.asyncType), + } } + actual := values[0].Interface() - if stopTryingErr, ok := asStopTryingError(actual); ok { - stopTrying = stopTryingErr + if _, ok := AsPollingSignalError(actual); ok { + return actual, actual.(error) } + + var err error for i, extraValue := range values[1:] { extra := extraValue.Interface() if extra == nil { continue } - if stopTryingErr, ok := asStopTryingError(extra); ok { - stopTrying = stopTryingErr - continue + if _, ok := AsPollingSignalError(extra); ok { + return actual, extra.(error) } - zero := reflect.Zero(reflect.TypeOf(extra)).Interface() + extraType := reflect.TypeOf(extra) + zero := reflect.Zero(extraType).Interface() if reflect.DeepEqual(extra, zero) { continue } + if i == len(values)-2 && extraType.Implements(errInterface) { + err = extra.(error) + } if err == nil { - err = fmt.Errorf("Unexpected non-nil/non-zero argument at index %d:\n\t<%T>: %#v", i+1, extra, extra) + err = &asyncPolledActualError{ + message: fmt.Sprintf("The function passed to %s had an unexpected non-nil/non-zero return value at index %d:\n%s", assertion.asyncType, i+1, format.Object(extra, 1)), + } } } - return actual, err, stopTrying -} -var gomegaType = reflect.TypeOf((*types.Gomega)(nil)).Elem() -var contextType = reflect.TypeOf(new(context.Context)).Elem() + return actual, err +} func (assertion *AsyncAssertion) invalidFunctionError(t reflect.Type) error { return fmt.Errorf(`The function passed to %s had an invalid signature of %s. Functions passed to %s must either: @@ -226,9 +230,16 @@ You can learn more at https://onsi.github.io/gomega/#eventually `, assertion.asyncType, t, t.NumIn(), numProvided, have, assertion.asyncType) } -func (assertion *AsyncAssertion) buildActualPoller() (func() (interface{}, error, StopTryingError), error) { +func (assertion *AsyncAssertion) invalidMustPassRepeatedlyError(reason string) error { + return fmt.Errorf(`Invalid use of MustPassRepeatedly with %s %s + +You can learn more at https://onsi.github.io/gomega/#eventually +`, assertion.asyncType, reason) +} + +func (assertion *AsyncAssertion) buildActualPoller() (func() (interface{}, error), error) { if !assertion.actualIsFunc { - return func() (interface{}, error, StopTryingError) { return assertion.actual, nil, nil }, nil + return func() (interface{}, error) { return assertion.actual, nil }, nil } actualValue := reflect.ValueOf(assertion.actual) actualType := reflect.TypeOf(assertion.actual) @@ -236,23 +247,11 @@ func (assertion *AsyncAssertion) buildActualPoller() (func() (interface{}, error if numIn == 0 && numOut == 0 { return nil, assertion.invalidFunctionError(actualType) - } else if numIn == 0 { - return func() (actual interface{}, err error, stopTrying StopTryingError) { - defer func() { - if e := recover(); e != nil { - if stopTryingErr, ok := asStopTryingError(e); ok { - stopTrying = stopTryingErr - } else { - panic(e) - } - } - }() - - actual, err, stopTrying = assertion.processReturnValues(actualValue.Call([]reflect.Value{})) - return - }, nil } - takesGomega, takesContext := actualType.In(0).Implements(gomegaType), actualType.In(0).Implements(contextType) + takesGomega, takesContext := false, false + if numIn > 0 { + takesGomega, takesContext = actualType.In(0).Implements(gomegaType), actualType.In(0).Implements(contextType) + } if takesGomega && numIn > 1 && actualType.In(1).Implements(contextType) { takesContext = true } @@ -275,8 +274,11 @@ func (assertion *AsyncAssertion) buildActualPoller() (func() (interface{}, error skip = callerSkip[0] } _, file, line, _ := runtime.Caller(skip + 1) - assertionFailure = fmt.Errorf("Assertion in callback at %s:%d failed:\n%s", file, line, message) - panic("stop execution") + assertionFailure = &asyncPolledActualError{ + message: fmt.Sprintf("The function passed to %s failed at %s:%d with:\n%s", assertion.asyncType, file, line, message), + } + // we throw an asyncGomegaHaltExecutionError so that defer GinkgoRecover() can catch this error if the user makes an assertion in a goroutine + panic(asyncGomegaHaltExecutionError{}) }))) } if takesContext { @@ -292,21 +294,29 @@ func (assertion *AsyncAssertion) buildActualPoller() (func() (interface{}, error return nil, assertion.argumentMismatchError(actualType, len(inValues)) } - return func() (actual interface{}, err error, stopTrying StopTryingError) { + if assertion.mustPassRepeatedly != 1 && assertion.asyncType != AsyncAssertionTypeEventually { + return nil, assertion.invalidMustPassRepeatedlyError("it can only be used with Eventually") + } + if assertion.mustPassRepeatedly < 1 { + return nil, assertion.invalidMustPassRepeatedlyError("parameter can't be < 1") + } + + return func() (actual interface{}, err error) { var values []reflect.Value assertionFailure = nil defer func() { - if numOut == 0 { + if numOut == 0 && takesGomega { actual = assertionFailure } else { - actual, err, stopTrying = assertion.processReturnValues(values) - if assertionFailure != nil { + actual, err = assertion.processReturnValues(values) + _, isAsyncError := AsPollingSignalError(err) + if assertionFailure != nil && !isAsyncError { err = assertionFailure } } if e := recover(); e != nil { - if stopTryingErr, ok := asStopTryingError(e); ok { - stopTrying = stopTryingErr + if _, isAsyncError := AsPollingSignalError(e); isAsyncError { + err = e.(error) } else if assertionFailure == nil { panic(e) } @@ -317,13 +327,6 @@ func (assertion *AsyncAssertion) buildActualPoller() (func() (interface{}, error }, nil } -func (assertion *AsyncAssertion) matcherSaysStopTrying(matcher types.GomegaMatcher, value interface{}) StopTryingError { - if assertion.actualIsFunc || types.MatchMayChangeInTheFuture(matcher, value) { - return nil - } - return StopTrying("No future change is possible. Bailing out early") -} - func (assertion *AsyncAssertion) afterTimeout() <-chan time.Time { if assertion.timeoutInterval >= 0 { return time.After(assertion.timeoutInterval) @@ -351,8 +354,27 @@ func (assertion *AsyncAssertion) afterPolling() <-chan time.Time { } } -type contextWithAttachProgressReporter interface { - AttachProgressReporter(func() string) func() +func (assertion *AsyncAssertion) matcherSaysStopTrying(matcher types.GomegaMatcher, value interface{}) bool { + if assertion.actualIsFunc || types.MatchMayChangeInTheFuture(matcher, value) { + return false + } + return true +} + +func (assertion *AsyncAssertion) pollMatcher(matcher types.GomegaMatcher, value interface{}) (matches bool, err error) { + defer func() { + if e := recover(); e != nil { + if _, isAsyncError := AsPollingSignalError(e); isAsyncError { + err = e.(error) + } else { + panic(e) + } + } + }() + + matches, err = matcher.Match(value) + + return } func (assertion *AsyncAssertion) match(matcher types.GomegaMatcher, desiredMatch bool, optionalDescription ...interface{}) bool { @@ -360,42 +382,95 @@ func (assertion *AsyncAssertion) match(matcher types.GomegaMatcher, desiredMatch timeout := assertion.afterTimeout() lock := sync.Mutex{} - var matches bool - var err error + var matches, hasLastValidActual bool + var actual, lastValidActual interface{} + var actualErr, matcherErr error + var oracleMatcherSaysStop bool assertion.g.THelper() - pollActual, err := assertion.buildActualPoller() - if err != nil { - assertion.g.Fail(err.Error(), 2+assertion.offset) + pollActual, buildActualPollerErr := assertion.buildActualPoller() + if buildActualPollerErr != nil { + assertion.g.Fail(buildActualPollerErr.Error(), 2+assertion.offset) return false } - value, err, stopTrying := pollActual() - if err == nil { - if stopTrying == nil { - stopTrying = assertion.matcherSaysStopTrying(matcher, value) + actual, actualErr = pollActual() + if actualErr == nil { + lastValidActual = actual + hasLastValidActual = true + oracleMatcherSaysStop = assertion.matcherSaysStopTrying(matcher, actual) + matches, matcherErr = assertion.pollMatcher(matcher, actual) + } + + renderError := func(preamble string, err error) string { + message := "" + if pollingSignalErr, ok := AsPollingSignalError(err); ok { + message = err.Error() + for _, attachment := range pollingSignalErr.Attachments { + message += fmt.Sprintf("\n%s:\n", attachment.Description) + message += format.Object(attachment.Object, 1) + } + } else { + message = preamble + "\n" + format.Object(err, 1) } - matches, err = matcher.Match(value) + return message } messageGenerator := func() string { // can be called out of band by Ginkgo if the user requests a progress report lock.Lock() defer lock.Unlock() - errMsg := "" message := "" - if err != nil { - errMsg = "Error: " + err.Error() + + if actualErr == nil { + if matcherErr == nil { + if desiredMatch != matches { + if desiredMatch { + message += matcher.FailureMessage(actual) + } else { + message += matcher.NegatedFailureMessage(actual) + } + } else { + if assertion.asyncType == AsyncAssertionTypeConsistently { + message += "There is no failure as the matcher passed to Consistently has not yet failed" + } else { + message += "There is no failure as the matcher passed to Eventually succeeded on its most recent iteration" + } + } + } else { + var fgErr formattedGomegaError + if errors.As(actualErr, &fgErr) { + message += fgErr.FormattedGomegaError() + "\n" + } else { + message += renderError(fmt.Sprintf("The matcher passed to %s returned the following error:", assertion.asyncType), matcherErr) + } + } } else { - if desiredMatch { - message = matcher.FailureMessage(value) + var fgErr formattedGomegaError + if errors.As(actualErr, &fgErr) { + message += fgErr.FormattedGomegaError() + "\n" } else { - message = matcher.NegatedFailureMessage(value) + message += renderError(fmt.Sprintf("The function passed to %s returned the following error:", assertion.asyncType), actualErr) + } + if hasLastValidActual { + message += fmt.Sprintf("\nAt one point, however, the function did return successfully.\nYet, %s failed because", assertion.asyncType) + _, e := matcher.Match(lastValidActual) + if e != nil { + message += renderError(" the matcher returned the following error:", e) + } else { + message += " the matcher was not satisfied:\n" + if desiredMatch { + message += matcher.FailureMessage(lastValidActual) + } else { + message += matcher.NegatedFailureMessage(lastValidActual) + } + } } } + description := assertion.buildDescription(optionalDescription...) - return fmt.Sprintf("%s%s%s", description, message, errMsg) + return fmt.Sprintf("%s%s", description, message) } fail := func(preamble string) { @@ -412,84 +487,85 @@ func (assertion *AsyncAssertion) match(matcher types.GomegaMatcher, desiredMatch } } - if assertion.asyncType == AsyncAssertionTypeEventually { - for { - if err == nil && matches == desiredMatch { - return true - } + // Used to count the number of times in a row a step passed + passedRepeatedlyCount := 0 + for { + var nextPoll <-chan time.Time = nil + var isTryAgainAfterError = false - if stopTrying != nil { - fail(stopTrying.Error() + " -") - return false - } - - select { - case <-assertion.afterPolling(): - v, e, st := pollActual() - if st != nil && st.wasViaPanic() { - // we were told to stop trying via panic - which means we dont' have reasonable new values - // we should simply use the old values and exit now - fail(st.Error() + " -") + for _, err := range []error{actualErr, matcherErr} { + if pollingSignalErr, ok := AsPollingSignalError(err); ok { + if pollingSignalErr.IsStopTrying() { + fail("Told to stop trying") return false } - lock.Lock() - value, err, stopTrying = v, e, st - lock.Unlock() - if err == nil { - if stopTrying == nil { - stopTrying = assertion.matcherSaysStopTrying(matcher, value) - } - matches, e = matcher.Match(value) - lock.Lock() - err = e - lock.Unlock() + if pollingSignalErr.IsTryAgainAfter() { + nextPoll = time.After(pollingSignalErr.TryAgainDuration()) + isTryAgainAfterError = true } - case <-contextDone: - fail("Context was cancelled") - return false - case <-timeout: - fail("Timed out") - return false } } - } else if assertion.asyncType == AsyncAssertionTypeConsistently { - for { - if !(err == nil && matches == desiredMatch) { + + if actualErr == nil && matcherErr == nil && matches == desiredMatch { + if assertion.asyncType == AsyncAssertionTypeEventually { + passedRepeatedlyCount += 1 + if passedRepeatedlyCount == assertion.mustPassRepeatedly { + return true + } + } + } else if !isTryAgainAfterError { + if assertion.asyncType == AsyncAssertionTypeConsistently { fail("Failed") return false } + // Reset the consecutive pass count + passedRepeatedlyCount = 0 + } - if stopTrying != nil { + if oracleMatcherSaysStop { + if assertion.asyncType == AsyncAssertionTypeEventually { + fail("No future change is possible. Bailing out early") + return false + } else { return true } + } - select { - case <-assertion.afterPolling(): - v, e, st := pollActual() - if st != nil && st.wasViaPanic() { - // we were told to stop trying via panic - which means we made it this far and should return successfully - return true - } + if nextPoll == nil { + nextPoll = assertion.afterPolling() + } + + select { + case <-nextPoll: + a, e := pollActual() + lock.Lock() + actual, actualErr = a, e + lock.Unlock() + if actualErr == nil { lock.Lock() - value, err, stopTrying = v, e, st + lastValidActual = actual + hasLastValidActual = true lock.Unlock() - if err == nil { - if stopTrying == nil { - stopTrying = assertion.matcherSaysStopTrying(matcher, value) - } - matches, e = matcher.Match(value) - lock.Lock() - err = e - lock.Unlock() - } - case <-contextDone: - fail("Context was cancelled") + oracleMatcherSaysStop = assertion.matcherSaysStopTrying(matcher, actual) + m, e := assertion.pollMatcher(matcher, actual) + lock.Lock() + matches, matcherErr = m, e + lock.Unlock() + } + case <-contextDone: + fail("Context was cancelled") + return false + case <-timeout: + if assertion.asyncType == AsyncAssertionTypeEventually { + fail("Timed out") return false - case <-timeout: + } else { + if isTryAgainAfterError { + fail("Timed out while waiting on TryAgainAfter") + return false + } return true } } } - - return false } diff --git a/vendor/github.com/onsi/gomega/internal/duration_bundle.go b/vendor/github.com/onsi/gomega/internal/duration_bundle.go index af8d989..6e0d90d 100644 --- a/vendor/github.com/onsi/gomega/internal/duration_bundle.go +++ b/vendor/github.com/onsi/gomega/internal/duration_bundle.go @@ -44,28 +44,28 @@ func durationFromEnv(key string, defaultDuration time.Duration) time.Duration { return duration } -func toDuration(input interface{}) time.Duration { +func toDuration(input interface{}) (time.Duration, error) { duration, ok := input.(time.Duration) if ok { - return duration + return duration, nil } value := reflect.ValueOf(input) kind := reflect.TypeOf(input).Kind() if reflect.Int <= kind && kind <= reflect.Int64 { - return time.Duration(value.Int()) * time.Second + return time.Duration(value.Int()) * time.Second, nil } else if reflect.Uint <= kind && kind <= reflect.Uint64 { - return time.Duration(value.Uint()) * time.Second + return time.Duration(value.Uint()) * time.Second, nil } else if reflect.Float32 <= kind && kind <= reflect.Float64 { - return time.Duration(value.Float() * float64(time.Second)) + return time.Duration(value.Float() * float64(time.Second)), nil } else if reflect.String == kind { duration, err := time.ParseDuration(value.String()) if err != nil { - panic(fmt.Sprintf("%#v is not a valid parsable duration string.", input)) + return 0, fmt.Errorf("%#v is not a valid parsable duration string: %w", input, err) } - return duration + return duration, nil } - panic(fmt.Sprintf("%v is not a valid interval. Must be time.Duration, parsable duration string or a number.", input)) + return 0, fmt.Errorf("%#v is not a valid interval. Must be a time.Duration, a parsable duration string, or a number.", input) } diff --git a/vendor/github.com/onsi/gomega/internal/gomega.go b/vendor/github.com/onsi/gomega/internal/gomega.go index 2d67f7f..de1f4f3 100644 --- a/vendor/github.com/onsi/gomega/internal/gomega.go +++ b/vendor/github.com/onsi/gomega/internal/gomega.go @@ -52,43 +52,42 @@ func (g *Gomega) ExpectWithOffset(offset int, actual interface{}, extra ...inter return NewAssertion(actual, g, offset, extra...) } -func (g *Gomega) Eventually(actual interface{}, intervals ...interface{}) types.AsyncAssertion { - return g.EventuallyWithOffset(0, actual, intervals...) +func (g *Gomega) Eventually(actualOrCtx interface{}, args ...interface{}) types.AsyncAssertion { + return g.makeAsyncAssertion(AsyncAssertionTypeEventually, 0, actualOrCtx, args...) } -func (g *Gomega) EventuallyWithOffset(offset int, actual interface{}, args ...interface{}) types.AsyncAssertion { - timeoutInterval := -time.Duration(1) - pollingInterval := -time.Duration(1) - intervals := []interface{}{} - var ctx context.Context - for _, arg := range args { - switch v := arg.(type) { - case context.Context: - ctx = v - default: - intervals = append(intervals, arg) - } - } - if len(intervals) > 0 { - timeoutInterval = toDuration(intervals[0]) - } - if len(intervals) > 1 { - pollingInterval = toDuration(intervals[1]) - } +func (g *Gomega) EventuallyWithOffset(offset int, actualOrCtx interface{}, args ...interface{}) types.AsyncAssertion { + return g.makeAsyncAssertion(AsyncAssertionTypeEventually, offset, actualOrCtx, args...) +} - return NewAsyncAssertion(AsyncAssertionTypeEventually, actual, g, timeoutInterval, pollingInterval, ctx, offset) +func (g *Gomega) Consistently(actualOrCtx interface{}, args ...interface{}) types.AsyncAssertion { + return g.makeAsyncAssertion(AsyncAssertionTypeConsistently, 0, actualOrCtx, args...) } -func (g *Gomega) Consistently(actual interface{}, intervals ...interface{}) types.AsyncAssertion { - return g.ConsistentlyWithOffset(0, actual, intervals...) +func (g *Gomega) ConsistentlyWithOffset(offset int, actualOrCtx interface{}, args ...interface{}) types.AsyncAssertion { + return g.makeAsyncAssertion(AsyncAssertionTypeConsistently, offset, actualOrCtx, args...) } -func (g *Gomega) ConsistentlyWithOffset(offset int, actual interface{}, args ...interface{}) types.AsyncAssertion { +func (g *Gomega) makeAsyncAssertion(asyncAssertionType AsyncAssertionType, offset int, actualOrCtx interface{}, args ...interface{}) types.AsyncAssertion { + baseOffset := 3 timeoutInterval := -time.Duration(1) pollingInterval := -time.Duration(1) intervals := []interface{}{} var ctx context.Context - for _, arg := range args { + + actual := actualOrCtx + startingIndex := 0 + if _, isCtx := actualOrCtx.(context.Context); isCtx && len(args) > 0 { + // the first argument is a context, we should accept it as the context _only if_ it is **not** the only argumnent **and** the second argument is not a parseable duration + // this is due to an unfortunate ambiguity in early version of Gomega in which multi-type durations are allowed after the actual + if _, err := toDuration(args[0]); err != nil { + ctx = actualOrCtx.(context.Context) + actual = args[0] + startingIndex = 1 + } + } + + for _, arg := range args[startingIndex:] { switch v := arg.(type) { case context.Context: ctx = v @@ -96,14 +95,21 @@ func (g *Gomega) ConsistentlyWithOffset(offset int, actual interface{}, args ... intervals = append(intervals, arg) } } + var err error if len(intervals) > 0 { - timeoutInterval = toDuration(intervals[0]) + timeoutInterval, err = toDuration(intervals[0]) + if err != nil { + g.Fail(err.Error(), offset+baseOffset) + } } if len(intervals) > 1 { - pollingInterval = toDuration(intervals[1]) + pollingInterval, err = toDuration(intervals[1]) + if err != nil { + g.Fail(err.Error(), offset+baseOffset) + } } - return NewAsyncAssertion(AsyncAssertionTypeConsistently, actual, g, timeoutInterval, pollingInterval, ctx, offset) + return NewAsyncAssertion(asyncAssertionType, actual, g, timeoutInterval, pollingInterval, 1, ctx, offset) } func (g *Gomega) SetDefaultEventuallyTimeout(t time.Duration) { diff --git a/vendor/github.com/onsi/gomega/internal/polling_signal_error.go b/vendor/github.com/onsi/gomega/internal/polling_signal_error.go new file mode 100644 index 0000000..83b04b1 --- /dev/null +++ b/vendor/github.com/onsi/gomega/internal/polling_signal_error.go @@ -0,0 +1,106 @@ +package internal + +import ( + "errors" + "fmt" + "time" +) + +type PollingSignalErrorType int + +const ( + PollingSignalErrorTypeStopTrying PollingSignalErrorType = iota + PollingSignalErrorTypeTryAgainAfter +) + +type PollingSignalError interface { + error + Wrap(err error) PollingSignalError + Attach(description string, obj any) PollingSignalError + Now() +} + +var StopTrying = func(message string) PollingSignalError { + return &PollingSignalErrorImpl{ + message: message, + pollingSignalErrorType: PollingSignalErrorTypeStopTrying, + } +} + +var TryAgainAfter = func(duration time.Duration) PollingSignalError { + return &PollingSignalErrorImpl{ + message: fmt.Sprintf("told to try again after %s", duration), + duration: duration, + pollingSignalErrorType: PollingSignalErrorTypeTryAgainAfter, + } +} + +type PollingSignalErrorAttachment struct { + Description string + Object any +} + +type PollingSignalErrorImpl struct { + message string + wrappedErr error + pollingSignalErrorType PollingSignalErrorType + duration time.Duration + Attachments []PollingSignalErrorAttachment +} + +func (s *PollingSignalErrorImpl) Wrap(err error) PollingSignalError { + s.wrappedErr = err + return s +} + +func (s *PollingSignalErrorImpl) Attach(description string, obj any) PollingSignalError { + s.Attachments = append(s.Attachments, PollingSignalErrorAttachment{description, obj}) + return s +} + +func (s *PollingSignalErrorImpl) Error() string { + if s.wrappedErr == nil { + return s.message + } else { + return s.message + ": " + s.wrappedErr.Error() + } +} + +func (s *PollingSignalErrorImpl) Unwrap() error { + if s == nil { + return nil + } + return s.wrappedErr +} + +func (s *PollingSignalErrorImpl) Now() { + panic(s) +} + +func (s *PollingSignalErrorImpl) IsStopTrying() bool { + return s.pollingSignalErrorType == PollingSignalErrorTypeStopTrying +} + +func (s *PollingSignalErrorImpl) IsTryAgainAfter() bool { + return s.pollingSignalErrorType == PollingSignalErrorTypeTryAgainAfter +} + +func (s *PollingSignalErrorImpl) TryAgainDuration() time.Duration { + return s.duration +} + +func AsPollingSignalError(actual interface{}) (*PollingSignalErrorImpl, bool) { + if actual == nil { + return nil, false + } + if actualErr, ok := actual.(error); ok { + var target *PollingSignalErrorImpl + if errors.As(actualErr, &target) { + return target, true + } else { + return nil, false + } + } + + return nil, false +} diff --git a/vendor/github.com/onsi/gomega/matchers.go b/vendor/github.com/onsi/gomega/matchers.go index f9d9f2a..bdaf62b 100644 --- a/vendor/github.com/onsi/gomega/matchers.go +++ b/vendor/github.com/onsi/gomega/matchers.go @@ -27,7 +27,8 @@ func BeEquivalentTo(expected interface{}) types.GomegaMatcher { } } -// BeComparableTo uses gocmp.Equal to compare. You can pass cmp.Option as options. +// BeComparableTo uses gocmp.Equal from github.com/google/go-cmp (instead of reflect.DeepEqual) to perform a deep comparison. +// You can pass cmp.Option as options. // It is an error for actual and expected to be nil. Use BeNil() instead. func BeComparableTo(expected interface{}, opts ...cmp.Option) types.GomegaMatcher { return &matchers.BeComparableToMatcher{ @@ -86,14 +87,17 @@ func Succeed() types.GomegaMatcher { return &matchers.SucceedMatcher{} } -// MatchError succeeds if actual is a non-nil error that matches the passed in string/error. +// MatchError succeeds if actual is a non-nil error that matches the passed in +// string, error, or matcher. // // These are valid use-cases: // // Expect(err).Should(MatchError("an error")) //asserts that err.Error() == "an error" // Expect(err).Should(MatchError(SomeError)) //asserts that err == SomeError (via reflect.DeepEqual) +// Expect(err).Should(MatchError(ContainSubstring("sprocket not found"))) // asserts that edrr.Error() contains substring "sprocket not found" // -// It is an error for err to be nil or an object that does not implement the Error interface +// It is an error for err to be nil or an object that does not implement the +// Error interface func MatchError(expected interface{}) types.GomegaMatcher { return &matchers.MatchErrorMatcher{ Expected: expected, @@ -348,6 +352,20 @@ func ConsistOf(elements ...interface{}) types.GomegaMatcher { } } +// HaveExactElemets succeeds if actual contains elements that precisely match the elemets passed into the matcher. The ordering of the elements does matter. +// By default HaveExactElements() uses Equal() to match the elements, however custom matchers can be passed in instead. Here are some examples: +// +// Expect([]string{"Foo", "FooBar"}).Should(HaveExactElements("Foo", "FooBar")) +// Expect([]string{"Foo", "FooBar"}).Should(HaveExactElements("Foo", ContainSubstring("Bar"))) +// Expect([]string{"Foo", "FooBar"}).Should(HaveExactElements(ContainSubstring("Foo"), ContainSubstring("Foo"))) +// +// Actual must be an array or slice. +func HaveExactElements(elements ...interface{}) types.GomegaMatcher { + return &matchers.HaveExactElementsMatcher{ + Elements: elements, + } +} + // ContainElements succeeds if actual contains the passed in elements. The ordering of the elements does not matter. // By default ContainElements() uses Equal() to match the elements, however custom matchers can be passed in instead. Here are some examples: // diff --git a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go b/vendor/github.com/onsi/gomega/matchers/be_a_directory.go index acffc85..93d4497 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go +++ b/vendor/github.com/onsi/gomega/matchers/be_a_directory.go @@ -52,5 +52,5 @@ func (matcher *BeADirectoryMatcher) FailureMessage(actual interface{}) (message } func (matcher *BeADirectoryMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not be a directory")) + return format.Message(actual, "not be a directory") } diff --git a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go b/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go index 89441c8..8fefc4d 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go +++ b/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go @@ -52,5 +52,5 @@ func (matcher *BeARegularFileMatcher) FailureMessage(actual interface{}) (messag } func (matcher *BeARegularFileMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not be a regular file")) + return format.Message(actual, "not be a regular file") } diff --git a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go b/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go index ec6506b..e2bdd28 100644 --- a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go +++ b/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go @@ -32,9 +32,9 @@ func (matcher *BeAnExistingFileMatcher) Match(actual interface{}) (success bool, } func (matcher *BeAnExistingFileMatcher) FailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("to exist")) + return format.Message(actual, "to exist") } func (matcher *BeAnExistingFileMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not to exist")) + return format.Message(actual, "not to exist") } diff --git a/vendor/github.com/onsi/gomega/matchers/consist_of.go b/vendor/github.com/onsi/gomega/matchers/consist_of.go index e8ef0de..f69037a 100644 --- a/vendor/github.com/onsi/gomega/matchers/consist_of.go +++ b/vendor/github.com/onsi/gomega/matchers/consist_of.go @@ -48,11 +48,13 @@ func neighbours(value, matcher interface{}) (bool, error) { func equalMatchersToElements(matchers []interface{}) (elements []interface{}) { for _, matcher := range matchers { - equalMatcher, ok := matcher.(*EqualMatcher) - if ok { - matcher = equalMatcher.Expected + if equalMatcher, ok := matcher.(*EqualMatcher); ok { + elements = append(elements, equalMatcher.Expected) + } else if _, ok := matcher.(*BeNilMatcher); ok { + elements = append(elements, nil) + } else { + elements = append(elements, matcher) } - elements = append(elements, matcher) } return } @@ -72,11 +74,13 @@ func flatten(elems []interface{}) []interface{} { func matchers(expectedElems []interface{}) (matchers []interface{}) { for _, e := range flatten(expectedElems) { - matcher, isMatcher := e.(omegaMatcher) - if !isMatcher { - matcher = &EqualMatcher{Expected: e} + if e == nil { + matchers = append(matchers, &BeNilMatcher{}) + } else if matcher, isMatcher := e.(omegaMatcher); isMatcher { + matchers = append(matchers, matcher) + } else { + matchers = append(matchers, &EqualMatcher{Expected: e}) } - matchers = append(matchers, matcher) } return } @@ -89,9 +93,14 @@ func presentable(elems []interface{}) interface{} { } sv := reflect.ValueOf(elems) - tt := sv.Index(0).Elem().Type() + firstEl := sv.Index(0) + if firstEl.IsNil() { + return elems + } + tt := firstEl.Elem().Type() for i := 1; i < sv.Len(); i++ { - if sv.Index(i).Elem().Type() != tt { + el := sv.Index(i) + if el.IsNil() || (sv.Index(i).Elem().Type() != tt) { return elems } } diff --git a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go b/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go new file mode 100644 index 0000000..dca5b94 --- /dev/null +++ b/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go @@ -0,0 +1,88 @@ +package matchers + +import ( + "fmt" + + "github.com/onsi/gomega/format" +) + +type mismatchFailure struct { + failure string + index int +} + +type HaveExactElementsMatcher struct { + Elements []interface{} + mismatchFailures []mismatchFailure + missingIndex int + extraIndex int +} + +func (matcher *HaveExactElementsMatcher) Match(actual interface{}) (success bool, err error) { + matcher.resetState() + + if isMap(actual) { + return false, fmt.Errorf("error") + } + + matchers := matchers(matcher.Elements) + values := valuesOf(actual) + + lenMatchers := len(matchers) + lenValues := len(values) + + for i := 0; i < lenMatchers || i < lenValues; i++ { + if i >= lenMatchers { + matcher.extraIndex = i + continue + } + + if i >= lenValues { + matcher.missingIndex = i + return + } + + elemMatcher := matchers[i].(omegaMatcher) + match, err := elemMatcher.Match(values[i]) + if err != nil { + matcher.mismatchFailures = append(matcher.mismatchFailures, mismatchFailure{ + index: i, + failure: err.Error(), + }) + } else if !match { + matcher.mismatchFailures = append(matcher.mismatchFailures, mismatchFailure{ + index: i, + failure: elemMatcher.FailureMessage(values[i]), + }) + } + } + + return matcher.missingIndex+matcher.extraIndex+len(matcher.mismatchFailures) == 0, nil +} + +func (matcher *HaveExactElementsMatcher) FailureMessage(actual interface{}) (message string) { + message = format.Message(actual, "to have exact elements with", presentable(matcher.Elements)) + if matcher.missingIndex > 0 { + message = fmt.Sprintf("%s\nthe missing elements start from index %d", message, matcher.missingIndex) + } + if matcher.extraIndex > 0 { + message = fmt.Sprintf("%s\nthe extra elements start from index %d", message, matcher.extraIndex) + } + if len(matcher.mismatchFailures) != 0 { + message = fmt.Sprintf("%s\nthe mismatch indexes were:", message) + } + for _, mismatch := range matcher.mismatchFailures { + message = fmt.Sprintf("%s\n%d: %s", message, mismatch.index, mismatch.failure) + } + return +} + +func (matcher *HaveExactElementsMatcher) NegatedFailureMessage(actual interface{}) (message string) { + return format.Message(actual, "not to contain elements", presentable(matcher.Elements)) +} + +func (matcher *HaveExactElementsMatcher) resetState() { + matcher.mismatchFailures = nil + matcher.missingIndex = 0 + matcher.extraIndex = 0 +} diff --git a/vendor/github.com/onsi/gomega/matchers/have_occurred_matcher.go b/vendor/github.com/onsi/gomega/matchers/have_occurred_matcher.go index 5bcfdd2..22a1b67 100644 --- a/vendor/github.com/onsi/gomega/matchers/have_occurred_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/have_occurred_matcher.go @@ -31,5 +31,5 @@ func (matcher *HaveOccurredMatcher) FailureMessage(actual interface{}) (message } func (matcher *HaveOccurredMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return fmt.Sprintf("Unexpected error:\n%s\n%s\n%s", format.Object(actual, 1), format.IndentString(actual.(error).Error(), 1), "occurred") + return fmt.Sprintf("Unexpected error:\n%s\n%s", format.Object(actual, 1), "occurred") } diff --git a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go b/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go index c8993a8..827475e 100644 --- a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go @@ -25,7 +25,17 @@ func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err e expected := matcher.Expected if isError(expected) { - return reflect.DeepEqual(actualErr, expected) || errors.Is(actualErr, expected.(error)), nil + // first try the built-in errors.Is + if errors.Is(actualErr, expected.(error)) { + return true, nil + } + // if not, try DeepEqual along the error chain + for unwrapped := actualErr; unwrapped != nil; unwrapped = errors.Unwrap(unwrapped) { + if reflect.DeepEqual(unwrapped, expected) { + return true, nil + } + } + return false, nil } if isString(expected) { diff --git a/vendor/github.com/onsi/gomega/matchers/succeed_matcher.go b/vendor/github.com/onsi/gomega/matchers/succeed_matcher.go index 721ed55..327350f 100644 --- a/vendor/github.com/onsi/gomega/matchers/succeed_matcher.go +++ b/vendor/github.com/onsi/gomega/matchers/succeed_matcher.go @@ -1,11 +1,16 @@ package matchers import ( + "errors" "fmt" "github.com/onsi/gomega/format" ) +type formattedGomegaError interface { + FormattedGomegaError() string +} + type SucceedMatcher struct { } @@ -25,7 +30,11 @@ func (matcher *SucceedMatcher) Match(actual interface{}) (success bool, err erro } func (matcher *SucceedMatcher) FailureMessage(actual interface{}) (message string) { - return fmt.Sprintf("Expected success, but got an error:\n%s\n%s", format.Object(actual, 1), format.IndentString(actual.(error).Error(), 1)) + var fgErr formattedGomegaError + if errors.As(actual.(error), &fgErr) { + return fgErr.FormattedGomegaError() + } + return fmt.Sprintf("Expected success, but got an error:\n%s", format.Object(actual, 1)) } func (matcher *SucceedMatcher) NegatedFailureMessage(actual interface{}) (message string) { diff --git a/vendor/github.com/onsi/gomega/tools b/vendor/github.com/onsi/gomega/tools deleted file mode 100644 index e4195cf..0000000 --- a/vendor/github.com/onsi/gomega/tools +++ /dev/null @@ -1,8 +0,0 @@ -//go:build tools -// +build tools - -package main - -import ( - _ "github.com/onsi/ginkgo/v2/ginkgo" -) diff --git a/vendor/github.com/onsi/gomega/types/types.go b/vendor/github.com/onsi/gomega/types/types.go index b479e2e..7c7adb9 100644 --- a/vendor/github.com/onsi/gomega/types/types.go +++ b/vendor/github.com/onsi/gomega/types/types.go @@ -19,11 +19,11 @@ type Gomega interface { Expect(actual interface{}, extra ...interface{}) Assertion ExpectWithOffset(offset int, actual interface{}, extra ...interface{}) Assertion - Eventually(actual interface{}, intervals ...interface{}) AsyncAssertion - EventuallyWithOffset(offset int, actual interface{}, intervals ...interface{}) AsyncAssertion + Eventually(actualOrCtx interface{}, args ...interface{}) AsyncAssertion + EventuallyWithOffset(offset int, actualOrCtx interface{}, args ...interface{}) AsyncAssertion - Consistently(actual interface{}, intervals ...interface{}) AsyncAssertion - ConsistentlyWithOffset(offset int, actual interface{}, intervals ...interface{}) AsyncAssertion + Consistently(actualOrCtx interface{}, args ...interface{}) AsyncAssertion + ConsistentlyWithOffset(offset int, actualOrCtx interface{}, args ...interface{}) AsyncAssertion SetDefaultEventuallyTimeout(time.Duration) SetDefaultEventuallyPollingInterval(time.Duration) @@ -75,6 +75,7 @@ type AsyncAssertion interface { ProbeEvery(interval time.Duration) AsyncAssertion WithContext(ctx context.Context) AsyncAssertion WithArguments(argsToForward ...interface{}) AsyncAssertion + MustPassRepeatedly(count int) AsyncAssertion } // Assertions are returned by Ω and Expect and enable assertions against Gomega matchers diff --git a/vendor/github.com/prometheus/procfs/Makefile.common b/vendor/github.com/prometheus/procfs/Makefile.common index 0ce7ea4..062a281 100644 --- a/vendor/github.com/prometheus/procfs/Makefile.common +++ b/vendor/github.com/prometheus/procfs/Makefile.common @@ -61,7 +61,7 @@ PROMU_URL := https://github.com/prometheus/promu/releases/download/v$(PROMU_ SKIP_GOLANGCI_LINT := GOLANGCI_LINT := GOLANGCI_LINT_OPTS ?= -GOLANGCI_LINT_VERSION ?= v1.53.3 +GOLANGCI_LINT_VERSION ?= v1.54.2 # golangci-lint only supports linux, darwin and windows platforms on i386/amd64. # windows isn't included here because of the path separator being different. ifeq ($(GOHOSTOS),$(filter $(GOHOSTOS),linux darwin)) diff --git a/vendor/github.com/prometheus/procfs/fs_statfs_notype.go b/vendor/github.com/prometheus/procfs/fs_statfs_notype.go index 13d74e3..134767d 100644 --- a/vendor/github.com/prometheus/procfs/fs_statfs_notype.go +++ b/vendor/github.com/prometheus/procfs/fs_statfs_notype.go @@ -11,8 +11,8 @@ // See the License for the specific language governing permissions and // limitations under the License. -//go:build netbsd || openbsd || solaris || windows || nostatfs -// +build netbsd openbsd solaris windows nostatfs +//go:build !freebsd && !linux +// +build !freebsd,!linux package procfs diff --git a/vendor/github.com/prometheus/procfs/fs_statfs_type.go b/vendor/github.com/prometheus/procfs/fs_statfs_type.go index bee1514..80df79c 100644 --- a/vendor/github.com/prometheus/procfs/fs_statfs_type.go +++ b/vendor/github.com/prometheus/procfs/fs_statfs_type.go @@ -11,8 +11,8 @@ // See the License for the specific language governing permissions and // limitations under the License. -//go:build !netbsd && !openbsd && !solaris && !windows && !nostatfs -// +build !netbsd,!openbsd,!solaris,!windows,!nostatfs +//go:build freebsd || linux +// +build freebsd linux package procfs diff --git a/vendor/github.com/prometheus/procfs/mountstats.go b/vendor/github.com/prometheus/procfs/mountstats.go index 852c8c4..9d8af6d 100644 --- a/vendor/github.com/prometheus/procfs/mountstats.go +++ b/vendor/github.com/prometheus/procfs/mountstats.go @@ -44,6 +44,14 @@ const ( fieldTransport11TCPLen = 13 fieldTransport11UDPLen = 10 + + // kernel version >= 4.14 MaxLen + // See: https://elixir.bootlin.com/linux/v6.4.8/source/net/sunrpc/xprtrdma/xprt_rdma.h#L393 + fieldTransport11RDMAMaxLen = 28 + + // kernel version <= 4.2 MinLen + // See: https://elixir.bootlin.com/linux/v4.2.8/source/net/sunrpc/xprtrdma/xprt_rdma.h#L331 + fieldTransport11RDMAMinLen = 20 ) // A Mount is a device mount parsed from /proc/[pid]/mountstats. @@ -233,6 +241,33 @@ type NFSTransportStats struct { // A running counter, incremented on each request as the current size of the // pending queue. CumulativePendingQueue uint64 + + // Stats below only available with stat version 1.1. + // Transport over RDMA + + // accessed when sending a call + ReadChunkCount uint64 + WriteChunkCount uint64 + ReplyChunkCount uint64 + TotalRdmaRequest uint64 + + // rarely accessed error counters + PullupCopyCount uint64 + HardwayRegisterCount uint64 + FailedMarshalCount uint64 + BadReplyCount uint64 + MrsRecovered uint64 + MrsOrphaned uint64 + MrsAllocated uint64 + EmptySendctxQ uint64 + + // accessed when receiving a reply + TotalRdmaReply uint64 + FixupCopyCount uint64 + ReplyWaitsForSend uint64 + LocalInvNeeded uint64 + NomsgCallCount uint64 + BcallCount uint64 } // parseMountStats parses a /proc/[pid]/mountstats file and returns a slice @@ -587,14 +622,17 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats expectedLength = fieldTransport11TCPLen } else if protocol == "udp" { expectedLength = fieldTransport11UDPLen + } else if protocol == "rdma" { + expectedLength = fieldTransport11RDMAMinLen } else { return nil, fmt.Errorf("%w: invalid NFS protocol \"%s\" in stats 1.1 statement: %v", ErrFileParse, protocol, ss) } - if len(ss) != expectedLength { - return nil, fmt.Errorf("%w: invalid NFS transport stats 1.1 statement: %v", ErrFileParse, ss) + if (len(ss) != expectedLength && (protocol == "tcp" || protocol == "udp")) || + (protocol == "rdma" && len(ss) < expectedLength) { + return nil, fmt.Errorf("%w: invalid NFS transport stats 1.1 statement: %v, protocol: %v", ErrFileParse, ss, protocol) } default: - return nil, fmt.Errorf("%s: Unrecognized NFS transport stats version: %q", ErrFileParse, statVersion) + return nil, fmt.Errorf("%s: Unrecognized NFS transport stats version: %q, protocol: %v", ErrFileParse, statVersion, protocol) } // Allocate enough for v1.1 stats since zero value for v1.1 stats will be okay @@ -604,7 +642,9 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats // Note: slice length must be set to length of v1.1 stats to avoid a panic when // only v1.0 stats are present. // See: https://github.com/prometheus/node_exporter/issues/571. - ns := make([]uint64, fieldTransport11TCPLen) + // + // Note: NFS Over RDMA slice length is fieldTransport11RDMAMaxLen + ns := make([]uint64, fieldTransport11RDMAMaxLen+3) for i, s := range ss { n, err := strconv.ParseUint(s, 10, 64) if err != nil { @@ -622,9 +662,14 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats // we set them to 0 here. if protocol == "udp" { ns = append(ns[:2], append(make([]uint64, 3), ns[2:]...)...) + } else if protocol == "tcp" { + ns = append(ns[:fieldTransport11TCPLen], make([]uint64, fieldTransport11RDMAMaxLen-fieldTransport11TCPLen+3)...) + } else if protocol == "rdma" { + ns = append(ns[:fieldTransport10TCPLen], append(make([]uint64, 3), ns[fieldTransport10TCPLen:]...)...) } return &NFSTransportStats{ + // NFS xprt over tcp or udp Protocol: protocol, Port: ns[0], Bind: ns[1], @@ -636,8 +681,32 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats BadTransactionIDs: ns[7], CumulativeActiveRequests: ns[8], CumulativeBacklog: ns[9], - MaximumRPCSlotsUsed: ns[10], - CumulativeSendingQueue: ns[11], - CumulativePendingQueue: ns[12], + + // NFS xprt over tcp or udp + // And statVersion 1.1 + MaximumRPCSlotsUsed: ns[10], + CumulativeSendingQueue: ns[11], + CumulativePendingQueue: ns[12], + + // NFS xprt over rdma + // And stat Version 1.1 + ReadChunkCount: ns[13], + WriteChunkCount: ns[14], + ReplyChunkCount: ns[15], + TotalRdmaRequest: ns[16], + PullupCopyCount: ns[17], + HardwayRegisterCount: ns[18], + FailedMarshalCount: ns[19], + BadReplyCount: ns[20], + MrsRecovered: ns[21], + MrsOrphaned: ns[22], + MrsAllocated: ns[23], + EmptySendctxQ: ns[24], + TotalRdmaReply: ns[25], + FixupCopyCount: ns[26], + ReplyWaitsForSend: ns[27], + LocalInvNeeded: ns[28], + NomsgCallCount: ns[29], + BcallCount: ns[30], }, nil } diff --git a/vendor/github.com/prometheus/procfs/proc_fdinfo.go b/vendor/github.com/prometheus/procfs/proc_fdinfo.go index 4b7933e..fa761b3 100644 --- a/vendor/github.com/prometheus/procfs/proc_fdinfo.go +++ b/vendor/github.com/prometheus/procfs/proc_fdinfo.go @@ -26,6 +26,7 @@ var ( rPos = regexp.MustCompile(`^pos:\s+(\d+)$`) rFlags = regexp.MustCompile(`^flags:\s+(\d+)$`) rMntID = regexp.MustCompile(`^mnt_id:\s+(\d+)$`) + rIno = regexp.MustCompile(`^ino:\s+(\d+)$`) rInotify = regexp.MustCompile(`^inotify`) rInotifyParts = regexp.MustCompile(`^inotify\s+wd:([0-9a-f]+)\s+ino:([0-9a-f]+)\s+sdev:([0-9a-f]+)(?:\s+mask:([0-9a-f]+))?`) ) @@ -40,6 +41,8 @@ type ProcFDInfo struct { Flags string // Mount point ID MntID string + // Inode number + Ino string // List of inotify lines (structured) in the fdinfo file (kernel 3.8+ only) InotifyInfos []InotifyInfo } @@ -51,7 +54,7 @@ func (p Proc) FDInfo(fd string) (*ProcFDInfo, error) { return nil, err } - var text, pos, flags, mntid string + var text, pos, flags, mntid, ino string var inotify []InotifyInfo scanner := bufio.NewScanner(bytes.NewReader(data)) @@ -63,6 +66,8 @@ func (p Proc) FDInfo(fd string) (*ProcFDInfo, error) { flags = rFlags.FindStringSubmatch(text)[1] } else if rMntID.MatchString(text) { mntid = rMntID.FindStringSubmatch(text)[1] + } else if rIno.MatchString(text) { + ino = rIno.FindStringSubmatch(text)[1] } else if rInotify.MatchString(text) { newInotify, err := parseInotifyInfo(text) if err != nil { @@ -77,6 +82,7 @@ func (p Proc) FDInfo(fd string) (*ProcFDInfo, error) { Pos: pos, Flags: flags, MntID: mntid, + Ino: ino, InotifyInfos: inotify, } diff --git a/vendor/github.com/prometheus/procfs/proc_maps.go b/vendor/github.com/prometheus/procfs/proc_maps.go index 727549a..7e75c28 100644 --- a/vendor/github.com/prometheus/procfs/proc_maps.go +++ b/vendor/github.com/prometheus/procfs/proc_maps.go @@ -63,17 +63,17 @@ type ProcMap struct { // parseDevice parses the device token of a line and converts it to a dev_t // (mkdev) like structure. func parseDevice(s string) (uint64, error) { - toks := strings.Split(s, ":") - if len(toks) < 2 { - return 0, fmt.Errorf("%w: unexpected number of fields, expected: 2, got: %q", ErrFileParse, len(toks)) + i := strings.Index(s, ":") + if i == -1 { + return 0, fmt.Errorf("%w: expected separator `:` in %s", ErrFileParse, s) } - major, err := strconv.ParseUint(toks[0], 16, 0) + major, err := strconv.ParseUint(s[0:i], 16, 0) if err != nil { return 0, err } - minor, err := strconv.ParseUint(toks[1], 16, 0) + minor, err := strconv.ParseUint(s[i+1:], 16, 0) if err != nil { return 0, err } @@ -93,17 +93,17 @@ func parseAddress(s string) (uintptr, error) { // parseAddresses parses the start-end address. func parseAddresses(s string) (uintptr, uintptr, error) { - toks := strings.Split(s, "-") - if len(toks) < 2 { - return 0, 0, fmt.Errorf("%w: invalid address", ErrFileParse) + idx := strings.Index(s, "-") + if idx == -1 { + return 0, 0, fmt.Errorf("%w: expected separator `-` in %s", ErrFileParse, s) } - saddr, err := parseAddress(toks[0]) + saddr, err := parseAddress(s[0:idx]) if err != nil { return 0, 0, err } - eaddr, err := parseAddress(toks[1]) + eaddr, err := parseAddress(s[idx+1:]) if err != nil { return 0, 0, err } diff --git a/vendor/github.com/prometheus/procfs/proc_status.go b/vendor/github.com/prometheus/procfs/proc_status.go index c055d07..46307f5 100644 --- a/vendor/github.com/prometheus/procfs/proc_status.go +++ b/vendor/github.com/prometheus/procfs/proc_status.go @@ -23,7 +23,7 @@ import ( ) // ProcStatus provides status information about the process, -// read from /proc/[pid]/stat. +// read from /proc/[pid]/status. type ProcStatus struct { // The process ID. PID int @@ -32,6 +32,8 @@ type ProcStatus struct { // Thread group ID. TGID int + // List of Pid namespace. + NSpids []uint64 // Peak virtual memory size. VmPeak uint64 // nolint:revive @@ -127,6 +129,8 @@ func (s *ProcStatus) fillStatus(k string, vString string, vUint uint64, vUintByt copy(s.UIDs[:], strings.Split(vString, "\t")) case "Gid": copy(s.GIDs[:], strings.Split(vString, "\t")) + case "NSpid": + s.NSpids = calcNSPidsList(vString) case "VmPeak": s.VmPeak = vUintBytes case "VmSize": @@ -200,3 +204,18 @@ func calcCpusAllowedList(cpuString string) []uint64 { sort.Slice(g, func(i, j int) bool { return g[i] < g[j] }) return g } + +func calcNSPidsList(nspidsString string) []uint64 { + s := strings.Split(nspidsString, " ") + var nspids []uint64 + + for _, nspid := range s { + nspid, _ := strconv.ParseUint(nspid, 10, 64) + if nspid == 0 { + continue + } + nspids = append(nspids, nspid) + } + + return nspids +} diff --git a/vendor/golang.org/x/exp/LICENSE b/vendor/golang.org/x/exp/LICENSE new file mode 100644 index 0000000..6a66aea --- /dev/null +++ b/vendor/golang.org/x/exp/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/exp/PATENTS b/vendor/golang.org/x/exp/PATENTS new file mode 100644 index 0000000..7330990 --- /dev/null +++ b/vendor/golang.org/x/exp/PATENTS @@ -0,0 +1,22 @@ +Additional IP Rights Grant (Patents) + +"This implementation" means the copyrightable works distributed by +Google as part of the Go project. + +Google hereby grants to You a perpetual, worldwide, non-exclusive, +no-charge, royalty-free, irrevocable (except as stated in this section) +patent license to make, have made, use, offer to sell, sell, import, +transfer and otherwise run, modify and propagate the contents of this +implementation of Go, where such license applies only to those patent +claims, both currently owned or controlled by Google and acquired in +the future, licensable by Google that are necessarily infringed by this +implementation of Go. This grant does not include claims that would be +infringed only as a consequence of further modification of this +implementation. If you or your agent or exclusive licensee institute or +order or agree to the institution of patent litigation against any +entity (including a cross-claim or counterclaim in a lawsuit) alleging +that this implementation of Go or any code incorporated within this +implementation of Go constitutes direct or contributory patent +infringement, or inducement of patent infringement, then any patent +rights granted to you under this License for this implementation of Go +shall terminate as of the date such litigation is filed. diff --git a/vendor/golang.org/x/exp/constraints/constraints.go b/vendor/golang.org/x/exp/constraints/constraints.go new file mode 100644 index 0000000..2c033df --- /dev/null +++ b/vendor/golang.org/x/exp/constraints/constraints.go @@ -0,0 +1,50 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package constraints defines a set of useful constraints to be used +// with type parameters. +package constraints + +// Signed is a constraint that permits any signed integer type. +// If future releases of Go add new predeclared signed integer types, +// this constraint will be modified to include them. +type Signed interface { + ~int | ~int8 | ~int16 | ~int32 | ~int64 +} + +// Unsigned is a constraint that permits any unsigned integer type. +// If future releases of Go add new predeclared unsigned integer types, +// this constraint will be modified to include them. +type Unsigned interface { + ~uint | ~uint8 | ~uint16 | ~uint32 | ~uint64 | ~uintptr +} + +// Integer is a constraint that permits any integer type. +// If future releases of Go add new predeclared integer types, +// this constraint will be modified to include them. +type Integer interface { + Signed | Unsigned +} + +// Float is a constraint that permits any floating-point type. +// If future releases of Go add new predeclared floating-point types, +// this constraint will be modified to include them. +type Float interface { + ~float32 | ~float64 +} + +// Complex is a constraint that permits any complex numeric type. +// If future releases of Go add new predeclared complex numeric types, +// this constraint will be modified to include them. +type Complex interface { + ~complex64 | ~complex128 +} + +// Ordered is a constraint that permits any ordered type: any type +// that supports the operators < <= >= >. +// If future releases of Go add new ordered types, +// this constraint will be modified to include them. +type Ordered interface { + Integer | Float | ~string +} diff --git a/vendor/golang.org/x/exp/slices/cmp.go b/vendor/golang.org/x/exp/slices/cmp.go new file mode 100644 index 0000000..fbf1934 --- /dev/null +++ b/vendor/golang.org/x/exp/slices/cmp.go @@ -0,0 +1,44 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package slices + +import "golang.org/x/exp/constraints" + +// min is a version of the predeclared function from the Go 1.21 release. +func min[T constraints.Ordered](a, b T) T { + if a < b || isNaN(a) { + return a + } + return b +} + +// max is a version of the predeclared function from the Go 1.21 release. +func max[T constraints.Ordered](a, b T) T { + if a > b || isNaN(a) { + return a + } + return b +} + +// cmpLess is a copy of cmp.Less from the Go 1.21 release. +func cmpLess[T constraints.Ordered](x, y T) bool { + return (isNaN(x) && !isNaN(y)) || x < y +} + +// cmpCompare is a copy of cmp.Compare from the Go 1.21 release. +func cmpCompare[T constraints.Ordered](x, y T) int { + xNaN := isNaN(x) + yNaN := isNaN(y) + if xNaN && yNaN { + return 0 + } + if xNaN || x < y { + return -1 + } + if yNaN || x > y { + return +1 + } + return 0 +} diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go new file mode 100644 index 0000000..5e8158b --- /dev/null +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -0,0 +1,499 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package slices defines various functions useful with slices of any type. +package slices + +import ( + "unsafe" + + "golang.org/x/exp/constraints" +) + +// Equal reports whether two slices are equal: the same length and all +// elements equal. If the lengths are different, Equal returns false. +// Otherwise, the elements are compared in increasing index order, and the +// comparison stops at the first unequal pair. +// Floating point NaNs are not considered equal. +func Equal[S ~[]E, E comparable](s1, s2 S) bool { + if len(s1) != len(s2) { + return false + } + for i := range s1 { + if s1[i] != s2[i] { + return false + } + } + return true +} + +// EqualFunc reports whether two slices are equal using an equality +// function on each pair of elements. If the lengths are different, +// EqualFunc returns false. Otherwise, the elements are compared in +// increasing index order, and the comparison stops at the first index +// for which eq returns false. +func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) bool) bool { + if len(s1) != len(s2) { + return false + } + for i, v1 := range s1 { + v2 := s2[i] + if !eq(v1, v2) { + return false + } + } + return true +} + +// Compare compares the elements of s1 and s2, using [cmp.Compare] on each pair +// of elements. The elements are compared sequentially, starting at index 0, +// until one element is not equal to the other. +// The result of comparing the first non-matching elements is returned. +// If both slices are equal until one of them ends, the shorter slice is +// considered less than the longer one. +// The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2. +func Compare[S ~[]E, E constraints.Ordered](s1, s2 S) int { + for i, v1 := range s1 { + if i >= len(s2) { + return +1 + } + v2 := s2[i] + if c := cmpCompare(v1, v2); c != 0 { + return c + } + } + if len(s1) < len(s2) { + return -1 + } + return 0 +} + +// CompareFunc is like [Compare] but uses a custom comparison function on each +// pair of elements. +// The result is the first non-zero result of cmp; if cmp always +// returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2), +// and +1 if len(s1) > len(s2). +func CompareFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, cmp func(E1, E2) int) int { + for i, v1 := range s1 { + if i >= len(s2) { + return +1 + } + v2 := s2[i] + if c := cmp(v1, v2); c != 0 { + return c + } + } + if len(s1) < len(s2) { + return -1 + } + return 0 +} + +// Index returns the index of the first occurrence of v in s, +// or -1 if not present. +func Index[S ~[]E, E comparable](s S, v E) int { + for i := range s { + if v == s[i] { + return i + } + } + return -1 +} + +// IndexFunc returns the first index i satisfying f(s[i]), +// or -1 if none do. +func IndexFunc[S ~[]E, E any](s S, f func(E) bool) int { + for i := range s { + if f(s[i]) { + return i + } + } + return -1 +} + +// Contains reports whether v is present in s. +func Contains[S ~[]E, E comparable](s S, v E) bool { + return Index(s, v) >= 0 +} + +// ContainsFunc reports whether at least one +// element e of s satisfies f(e). +func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { + return IndexFunc(s, f) >= 0 +} + +// Insert inserts the values v... into s at index i, +// returning the modified slice. +// The elements at s[i:] are shifted up to make room. +// In the returned slice r, r[i] == v[0], +// and r[i+len(v)] == value originally at r[i]. +// Insert panics if i is out of range. +// This function is O(len(s) + len(v)). +func Insert[S ~[]E, E any](s S, i int, v ...E) S { + m := len(v) + if m == 0 { + return s + } + n := len(s) + if i == n { + return append(s, v...) + } + if n+m > cap(s) { + // Use append rather than make so that we bump the size of + // the slice up to the next storage class. + // This is what Grow does but we don't call Grow because + // that might copy the values twice. + s2 := append(s[:i], make(S, n+m-i)...) + copy(s2[i:], v) + copy(s2[i+m:], s[i:]) + return s2 + } + s = s[:n+m] + + // before: + // s: aaaaaaaabbbbccccccccdddd + // ^ ^ ^ ^ + // i i+m n n+m + // after: + // s: aaaaaaaavvvvbbbbcccccccc + // ^ ^ ^ ^ + // i i+m n n+m + // + // a are the values that don't move in s. + // v are the values copied in from v. + // b and c are the values from s that are shifted up in index. + // d are the values that get overwritten, never to be seen again. + + if !overlaps(v, s[i+m:]) { + // Easy case - v does not overlap either the c or d regions. + // (It might be in some of a or b, or elsewhere entirely.) + // The data we copy up doesn't write to v at all, so just do it. + + copy(s[i+m:], s[i:]) + + // Now we have + // s: aaaaaaaabbbbbbbbcccccccc + // ^ ^ ^ ^ + // i i+m n n+m + // Note the b values are duplicated. + + copy(s[i:], v) + + // Now we have + // s: aaaaaaaavvvvbbbbcccccccc + // ^ ^ ^ ^ + // i i+m n n+m + // That's the result we want. + return s + } + + // The hard case - v overlaps c or d. We can't just shift up + // the data because we'd move or clobber the values we're trying + // to insert. + // So instead, write v on top of d, then rotate. + copy(s[n:], v) + + // Now we have + // s: aaaaaaaabbbbccccccccvvvv + // ^ ^ ^ ^ + // i i+m n n+m + + rotateRight(s[i:], m) + + // Now we have + // s: aaaaaaaavvvvbbbbcccccccc + // ^ ^ ^ ^ + // i i+m n n+m + // That's the result we want. + return s +} + +// Delete removes the elements s[i:j] from s, returning the modified slice. +// Delete panics if s[i:j] is not a valid slice of s. +// Delete is O(len(s)-j), so if many items must be deleted, it is better to +// make a single call deleting them all together than to delete one at a time. +// Delete might not modify the elements s[len(s)-(j-i):len(s)]. If those +// elements contain pointers you might consider zeroing those elements so that +// objects they reference can be garbage collected. +func Delete[S ~[]E, E any](s S, i, j int) S { + _ = s[i:j] // bounds check + + return append(s[:i], s[j:]...) +} + +// DeleteFunc removes any elements from s for which del returns true, +// returning the modified slice. +// When DeleteFunc removes m elements, it might not modify the elements +// s[len(s)-m:len(s)]. If those elements contain pointers you might consider +// zeroing those elements so that objects they reference can be garbage +// collected. +func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { + i := IndexFunc(s, del) + if i == -1 { + return s + } + // Don't start copying elements until we find one to delete. + for j := i + 1; j < len(s); j++ { + if v := s[j]; !del(v) { + s[i] = v + i++ + } + } + return s[:i] +} + +// Replace replaces the elements s[i:j] by the given v, and returns the +// modified slice. Replace panics if s[i:j] is not a valid slice of s. +func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { + _ = s[i:j] // verify that i:j is a valid subslice + + if i == j { + return Insert(s, i, v...) + } + if j == len(s) { + return append(s[:i], v...) + } + + tot := len(s[:i]) + len(v) + len(s[j:]) + if tot > cap(s) { + // Too big to fit, allocate and copy over. + s2 := append(s[:i], make(S, tot-i)...) // See Insert + copy(s2[i:], v) + copy(s2[i+len(v):], s[j:]) + return s2 + } + + r := s[:tot] + + if i+len(v) <= j { + // Easy, as v fits in the deleted portion. + copy(r[i:], v) + if i+len(v) != j { + copy(r[i+len(v):], s[j:]) + } + return r + } + + // We are expanding (v is bigger than j-i). + // The situation is something like this: + // (example has i=4,j=8,len(s)=16,len(v)=6) + // s: aaaaxxxxbbbbbbbbyy + // ^ ^ ^ ^ + // i j len(s) tot + // a: prefix of s + // x: deleted range + // b: more of s + // y: area to expand into + + if !overlaps(r[i+len(v):], v) { + // Easy, as v is not clobbered by the first copy. + copy(r[i+len(v):], s[j:]) + copy(r[i:], v) + return r + } + + // This is a situation where we don't have a single place to which + // we can copy v. Parts of it need to go to two different places. + // We want to copy the prefix of v into y and the suffix into x, then + // rotate |y| spots to the right. + // + // v[2:] v[:2] + // | | + // s: aaaavvvvbbbbbbbbvv + // ^ ^ ^ ^ + // i j len(s) tot + // + // If either of those two destinations don't alias v, then we're good. + y := len(v) - (j - i) // length of y portion + + if !overlaps(r[i:j], v) { + copy(r[i:j], v[y:]) + copy(r[len(s):], v[:y]) + rotateRight(r[i:], y) + return r + } + if !overlaps(r[len(s):], v) { + copy(r[len(s):], v[:y]) + copy(r[i:j], v[y:]) + rotateRight(r[i:], y) + return r + } + + // Now we know that v overlaps both x and y. + // That means that the entirety of b is *inside* v. + // So we don't need to preserve b at all; instead we + // can copy v first, then copy the b part of v out of + // v to the right destination. + k := startIdx(v, s[j:]) + copy(r[i:], v) + copy(r[i+len(v):], r[i+k:]) + return r +} + +// Clone returns a copy of the slice. +// The elements are copied using assignment, so this is a shallow clone. +func Clone[S ~[]E, E any](s S) S { + // Preserve nil in case it matters. + if s == nil { + return nil + } + return append(S([]E{}), s...) +} + +// Compact replaces consecutive runs of equal elements with a single copy. +// This is like the uniq command found on Unix. +// Compact modifies the contents of the slice s and returns the modified slice, +// which may have a smaller length. +// When Compact discards m elements in total, it might not modify the elements +// s[len(s)-m:len(s)]. If those elements contain pointers you might consider +// zeroing those elements so that objects they reference can be garbage collected. +func Compact[S ~[]E, E comparable](s S) S { + if len(s) < 2 { + return s + } + i := 1 + for k := 1; k < len(s); k++ { + if s[k] != s[k-1] { + if i != k { + s[i] = s[k] + } + i++ + } + } + return s[:i] +} + +// CompactFunc is like [Compact] but uses an equality function to compare elements. +// For runs of elements that compare equal, CompactFunc keeps the first one. +func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { + if len(s) < 2 { + return s + } + i := 1 + for k := 1; k < len(s); k++ { + if !eq(s[k], s[k-1]) { + if i != k { + s[i] = s[k] + } + i++ + } + } + return s[:i] +} + +// Grow increases the slice's capacity, if necessary, to guarantee space for +// another n elements. After Grow(n), at least n elements can be appended +// to the slice without another allocation. If n is negative or too large to +// allocate the memory, Grow panics. +func Grow[S ~[]E, E any](s S, n int) S { + if n < 0 { + panic("cannot be negative") + } + if n -= cap(s) - len(s); n > 0 { + // TODO(https://go.dev/issue/53888): Make using []E instead of S + // to workaround a compiler bug where the runtime.growslice optimization + // does not take effect. Revert when the compiler is fixed. + s = append([]E(s)[:cap(s)], make([]E, n)...)[:len(s)] + } + return s +} + +// Clip removes unused capacity from the slice, returning s[:len(s):len(s)]. +func Clip[S ~[]E, E any](s S) S { + return s[:len(s):len(s)] +} + +// Rotation algorithm explanation: +// +// rotate left by 2 +// start with +// 0123456789 +// split up like this +// 01 234567 89 +// swap first 2 and last 2 +// 89 234567 01 +// join first parts +// 89234567 01 +// recursively rotate first left part by 2 +// 23456789 01 +// join at the end +// 2345678901 +// +// rotate left by 8 +// start with +// 0123456789 +// split up like this +// 01 234567 89 +// swap first 2 and last 2 +// 89 234567 01 +// join last parts +// 89 23456701 +// recursively rotate second part left by 6 +// 89 01234567 +// join at the end +// 8901234567 + +// TODO: There are other rotate algorithms. +// This algorithm has the desirable property that it moves each element exactly twice. +// The triple-reverse algorithm is simpler and more cache friendly, but takes more writes. +// The follow-cycles algorithm can be 1-write but it is not very cache friendly. + +// rotateLeft rotates b left by n spaces. +// s_final[i] = s_orig[i+r], wrapping around. +func rotateLeft[E any](s []E, r int) { + for r != 0 && r != len(s) { + if r*2 <= len(s) { + swap(s[:r], s[len(s)-r:]) + s = s[:len(s)-r] + } else { + swap(s[:len(s)-r], s[r:]) + s, r = s[len(s)-r:], r*2-len(s) + } + } +} +func rotateRight[E any](s []E, r int) { + rotateLeft(s, len(s)-r) +} + +// swap swaps the contents of x and y. x and y must be equal length and disjoint. +func swap[E any](x, y []E) { + for i := 0; i < len(x); i++ { + x[i], y[i] = y[i], x[i] + } +} + +// overlaps reports whether the memory ranges a[0:len(a)] and b[0:len(b)] overlap. +func overlaps[E any](a, b []E) bool { + if len(a) == 0 || len(b) == 0 { + return false + } + elemSize := unsafe.Sizeof(a[0]) + if elemSize == 0 { + return false + } + // TODO: use a runtime/unsafe facility once one becomes available. See issue 12445. + // Also see crypto/internal/alias/alias.go:AnyOverlap + return uintptr(unsafe.Pointer(&a[0])) <= uintptr(unsafe.Pointer(&b[len(b)-1]))+(elemSize-1) && + uintptr(unsafe.Pointer(&b[0])) <= uintptr(unsafe.Pointer(&a[len(a)-1]))+(elemSize-1) +} + +// startIdx returns the index in haystack where the needle starts. +// prerequisite: the needle must be aliased entirely inside the haystack. +func startIdx[E any](haystack, needle []E) int { + p := &needle[0] + for i := range haystack { + if p == &haystack[i] { + return i + } + } + // TODO: what if the overlap is by a non-integral number of Es? + panic("needle not found") +} + +// Reverse reverses the elements of the slice in place. +func Reverse[S ~[]E, E any](s S) { + for i, j := 0, len(s)-1; i < j; i, j = i+1, j-1 { + s[i], s[j] = s[j], s[i] + } +} diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go new file mode 100644 index 0000000..b67897f --- /dev/null +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -0,0 +1,195 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run $GOROOT/src/sort/gen_sort_variants.go -exp + +package slices + +import ( + "math/bits" + + "golang.org/x/exp/constraints" +) + +// Sort sorts a slice of any ordered type in ascending order. +// When sorting floating-point numbers, NaNs are ordered before other values. +func Sort[S ~[]E, E constraints.Ordered](x S) { + n := len(x) + pdqsortOrdered(x, 0, n, bits.Len(uint(n))) +} + +// SortFunc sorts the slice x in ascending order as determined by the cmp +// function. This sort is not guaranteed to be stable. +// cmp(a, b) should return a negative number when a < b, a positive number when +// a > b and zero when a == b. +// +// SortFunc requires that cmp is a strict weak ordering. +// See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings. +func SortFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { + n := len(x) + pdqsortCmpFunc(x, 0, n, bits.Len(uint(n)), cmp) +} + +// SortStableFunc sorts the slice x while keeping the original order of equal +// elements, using cmp to compare elements in the same way as [SortFunc]. +func SortStableFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { + stableCmpFunc(x, len(x), cmp) +} + +// IsSorted reports whether x is sorted in ascending order. +func IsSorted[S ~[]E, E constraints.Ordered](x S) bool { + for i := len(x) - 1; i > 0; i-- { + if cmpLess(x[i], x[i-1]) { + return false + } + } + return true +} + +// IsSortedFunc reports whether x is sorted in ascending order, with cmp as the +// comparison function as defined by [SortFunc]. +func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { + for i := len(x) - 1; i > 0; i-- { + if cmp(x[i], x[i-1]) < 0 { + return false + } + } + return true +} + +// Min returns the minimal value in x. It panics if x is empty. +// For floating-point numbers, Min propagates NaNs (any NaN value in x +// forces the output to be NaN). +func Min[S ~[]E, E constraints.Ordered](x S) E { + if len(x) < 1 { + panic("slices.Min: empty list") + } + m := x[0] + for i := 1; i < len(x); i++ { + m = min(m, x[i]) + } + return m +} + +// MinFunc returns the minimal value in x, using cmp to compare elements. +// It panics if x is empty. If there is more than one minimal element +// according to the cmp function, MinFunc returns the first one. +func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { + if len(x) < 1 { + panic("slices.MinFunc: empty list") + } + m := x[0] + for i := 1; i < len(x); i++ { + if cmp(x[i], m) < 0 { + m = x[i] + } + } + return m +} + +// Max returns the maximal value in x. It panics if x is empty. +// For floating-point E, Max propagates NaNs (any NaN value in x +// forces the output to be NaN). +func Max[S ~[]E, E constraints.Ordered](x S) E { + if len(x) < 1 { + panic("slices.Max: empty list") + } + m := x[0] + for i := 1; i < len(x); i++ { + m = max(m, x[i]) + } + return m +} + +// MaxFunc returns the maximal value in x, using cmp to compare elements. +// It panics if x is empty. If there is more than one maximal element +// according to the cmp function, MaxFunc returns the first one. +func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { + if len(x) < 1 { + panic("slices.MaxFunc: empty list") + } + m := x[0] + for i := 1; i < len(x); i++ { + if cmp(x[i], m) > 0 { + m = x[i] + } + } + return m +} + +// BinarySearch searches for target in a sorted slice and returns the position +// where target is found, or the position where target would appear in the +// sort order; it also returns a bool saying whether the target is really found +// in the slice. The slice must be sorted in increasing order. +func BinarySearch[S ~[]E, E constraints.Ordered](x S, target E) (int, bool) { + // Inlining is faster than calling BinarySearchFunc with a lambda. + n := len(x) + // Define x[-1] < target and x[n] >= target. + // Invariant: x[i-1] < target, x[j] >= target. + i, j := 0, n + for i < j { + h := int(uint(i+j) >> 1) // avoid overflow when computing h + // i ≤ h < j + if cmpLess(x[h], target) { + i = h + 1 // preserves x[i-1] < target + } else { + j = h // preserves x[j] >= target + } + } + // i == j, x[i-1] < target, and x[j] (= x[i]) >= target => answer is i. + return i, i < n && (x[i] == target || (isNaN(x[i]) && isNaN(target))) +} + +// BinarySearchFunc works like [BinarySearch], but uses a custom comparison +// function. The slice must be sorted in increasing order, where "increasing" +// is defined by cmp. cmp should return 0 if the slice element matches +// the target, a negative number if the slice element precedes the target, +// or a positive number if the slice element follows the target. +// cmp must implement the same ordering as the slice, such that if +// cmp(a, t) < 0 and cmp(b, t) >= 0, then a must precede b in the slice. +func BinarySearchFunc[S ~[]E, E, T any](x S, target T, cmp func(E, T) int) (int, bool) { + n := len(x) + // Define cmp(x[-1], target) < 0 and cmp(x[n], target) >= 0 . + // Invariant: cmp(x[i - 1], target) < 0, cmp(x[j], target) >= 0. + i, j := 0, n + for i < j { + h := int(uint(i+j) >> 1) // avoid overflow when computing h + // i ≤ h < j + if cmp(x[h], target) < 0 { + i = h + 1 // preserves cmp(x[i - 1], target) < 0 + } else { + j = h // preserves cmp(x[j], target) >= 0 + } + } + // i == j, cmp(x[i-1], target) < 0, and cmp(x[j], target) (= cmp(x[i], target)) >= 0 => answer is i. + return i, i < n && cmp(x[i], target) == 0 +} + +type sortedHint int // hint for pdqsort when choosing the pivot + +const ( + unknownHint sortedHint = iota + increasingHint + decreasingHint +) + +// xorshift paper: https://www.jstatsoft.org/article/view/v008i14/xorshift.pdf +type xorshift uint64 + +func (r *xorshift) Next() uint64 { + *r ^= *r << 13 + *r ^= *r >> 17 + *r ^= *r << 5 + return uint64(*r) +} + +func nextPowerOfTwo(length int) uint { + return 1 << bits.Len(uint(length)) +} + +// isNaN reports whether x is a NaN without requiring the math package. +// This will always return false if T is not floating-point. +func isNaN[T constraints.Ordered](x T) bool { + return x != x +} diff --git a/vendor/golang.org/x/exp/slices/zsortanyfunc.go b/vendor/golang.org/x/exp/slices/zsortanyfunc.go new file mode 100644 index 0000000..06f2c7a --- /dev/null +++ b/vendor/golang.org/x/exp/slices/zsortanyfunc.go @@ -0,0 +1,479 @@ +// Code generated by gen_sort_variants.go; DO NOT EDIT. + +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package slices + +// insertionSortCmpFunc sorts data[a:b] using insertion sort. +func insertionSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { + for i := a + 1; i < b; i++ { + for j := i; j > a && (cmp(data[j], data[j-1]) < 0); j-- { + data[j], data[j-1] = data[j-1], data[j] + } + } +} + +// siftDownCmpFunc implements the heap property on data[lo:hi]. +// first is an offset into the array where the root of the heap lies. +func siftDownCmpFunc[E any](data []E, lo, hi, first int, cmp func(a, b E) int) { + root := lo + for { + child := 2*root + 1 + if child >= hi { + break + } + if child+1 < hi && (cmp(data[first+child], data[first+child+1]) < 0) { + child++ + } + if !(cmp(data[first+root], data[first+child]) < 0) { + return + } + data[first+root], data[first+child] = data[first+child], data[first+root] + root = child + } +} + +func heapSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { + first := a + lo := 0 + hi := b - a + + // Build heap with greatest element at top. + for i := (hi - 1) / 2; i >= 0; i-- { + siftDownCmpFunc(data, i, hi, first, cmp) + } + + // Pop elements, largest first, into end of data. + for i := hi - 1; i >= 0; i-- { + data[first], data[first+i] = data[first+i], data[first] + siftDownCmpFunc(data, lo, i, first, cmp) + } +} + +// pdqsortCmpFunc sorts data[a:b]. +// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. +// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf +// C++ implementation: https://github.com/orlp/pdqsort +// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ +// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. +func pdqsortCmpFunc[E any](data []E, a, b, limit int, cmp func(a, b E) int) { + const maxInsertion = 12 + + var ( + wasBalanced = true // whether the last partitioning was reasonably balanced + wasPartitioned = true // whether the slice was already partitioned + ) + + for { + length := b - a + + if length <= maxInsertion { + insertionSortCmpFunc(data, a, b, cmp) + return + } + + // Fall back to heapsort if too many bad choices were made. + if limit == 0 { + heapSortCmpFunc(data, a, b, cmp) + return + } + + // If the last partitioning was imbalanced, we need to breaking patterns. + if !wasBalanced { + breakPatternsCmpFunc(data, a, b, cmp) + limit-- + } + + pivot, hint := choosePivotCmpFunc(data, a, b, cmp) + if hint == decreasingHint { + reverseRangeCmpFunc(data, a, b, cmp) + // The chosen pivot was pivot-a elements after the start of the array. + // After reversing it is pivot-a elements before the end of the array. + // The idea came from Rust's implementation. + pivot = (b - 1) - (pivot - a) + hint = increasingHint + } + + // The slice is likely already sorted. + if wasBalanced && wasPartitioned && hint == increasingHint { + if partialInsertionSortCmpFunc(data, a, b, cmp) { + return + } + } + + // Probably the slice contains many duplicate elements, partition the slice into + // elements equal to and elements greater than the pivot. + if a > 0 && !(cmp(data[a-1], data[pivot]) < 0) { + mid := partitionEqualCmpFunc(data, a, b, pivot, cmp) + a = mid + continue + } + + mid, alreadyPartitioned := partitionCmpFunc(data, a, b, pivot, cmp) + wasPartitioned = alreadyPartitioned + + leftLen, rightLen := mid-a, b-mid + balanceThreshold := length / 8 + if leftLen < rightLen { + wasBalanced = leftLen >= balanceThreshold + pdqsortCmpFunc(data, a, mid, limit, cmp) + a = mid + 1 + } else { + wasBalanced = rightLen >= balanceThreshold + pdqsortCmpFunc(data, mid+1, b, limit, cmp) + b = mid + } + } +} + +// partitionCmpFunc does one quicksort partition. +// Let p = data[pivot] +// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. +// On return, data[newpivot] = p +func partitionCmpFunc[E any](data []E, a, b, pivot int, cmp func(a, b E) int) (newpivot int, alreadyPartitioned bool) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for i <= j && (cmp(data[i], data[a]) < 0) { + i++ + } + for i <= j && !(cmp(data[j], data[a]) < 0) { + j-- + } + if i > j { + data[j], data[a] = data[a], data[j] + return j, true + } + data[i], data[j] = data[j], data[i] + i++ + j-- + + for { + for i <= j && (cmp(data[i], data[a]) < 0) { + i++ + } + for i <= j && !(cmp(data[j], data[a]) < 0) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + data[j], data[a] = data[a], data[j] + return j, false +} + +// partitionEqualCmpFunc partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. +// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. +func partitionEqualCmpFunc[E any](data []E, a, b, pivot int, cmp func(a, b E) int) (newpivot int) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for { + for i <= j && !(cmp(data[a], data[i]) < 0) { + i++ + } + for i <= j && (cmp(data[a], data[j]) < 0) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + return i +} + +// partialInsertionSortCmpFunc partially sorts a slice, returns true if the slice is sorted at the end. +func partialInsertionSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) bool { + const ( + maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted + shortestShifting = 50 // don't shift any elements on short arrays + ) + i := a + 1 + for j := 0; j < maxSteps; j++ { + for i < b && !(cmp(data[i], data[i-1]) < 0) { + i++ + } + + if i == b { + return true + } + + if b-a < shortestShifting { + return false + } + + data[i], data[i-1] = data[i-1], data[i] + + // Shift the smaller one to the left. + if i-a >= 2 { + for j := i - 1; j >= 1; j-- { + if !(cmp(data[j], data[j-1]) < 0) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + // Shift the greater one to the right. + if b-i >= 2 { + for j := i + 1; j < b; j++ { + if !(cmp(data[j], data[j-1]) < 0) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + } + return false +} + +// breakPatternsCmpFunc scatters some elements around in an attempt to break some patterns +// that might cause imbalanced partitions in quicksort. +func breakPatternsCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { + length := b - a + if length >= 8 { + random := xorshift(length) + modulus := nextPowerOfTwo(length) + + for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { + other := int(uint(random.Next()) & (modulus - 1)) + if other >= length { + other -= length + } + data[idx], data[a+other] = data[a+other], data[idx] + } + } +} + +// choosePivotCmpFunc chooses a pivot in data[a:b]. +// +// [0,8): chooses a static pivot. +// [8,shortestNinther): uses the simple median-of-three method. +// [shortestNinther,∞): uses the Tukey ninther method. +func choosePivotCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) (pivot int, hint sortedHint) { + const ( + shortestNinther = 50 + maxSwaps = 4 * 3 + ) + + l := b - a + + var ( + swaps int + i = a + l/4*1 + j = a + l/4*2 + k = a + l/4*3 + ) + + if l >= 8 { + if l >= shortestNinther { + // Tukey ninther method, the idea came from Rust's implementation. + i = medianAdjacentCmpFunc(data, i, &swaps, cmp) + j = medianAdjacentCmpFunc(data, j, &swaps, cmp) + k = medianAdjacentCmpFunc(data, k, &swaps, cmp) + } + // Find the median among i, j, k and stores it into j. + j = medianCmpFunc(data, i, j, k, &swaps, cmp) + } + + switch swaps { + case 0: + return j, increasingHint + case maxSwaps: + return j, decreasingHint + default: + return j, unknownHint + } +} + +// order2CmpFunc returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. +func order2CmpFunc[E any](data []E, a, b int, swaps *int, cmp func(a, b E) int) (int, int) { + if cmp(data[b], data[a]) < 0 { + *swaps++ + return b, a + } + return a, b +} + +// medianCmpFunc returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. +func medianCmpFunc[E any](data []E, a, b, c int, swaps *int, cmp func(a, b E) int) int { + a, b = order2CmpFunc(data, a, b, swaps, cmp) + b, c = order2CmpFunc(data, b, c, swaps, cmp) + a, b = order2CmpFunc(data, a, b, swaps, cmp) + return b +} + +// medianAdjacentCmpFunc finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. +func medianAdjacentCmpFunc[E any](data []E, a int, swaps *int, cmp func(a, b E) int) int { + return medianCmpFunc(data, a-1, a, a+1, swaps, cmp) +} + +func reverseRangeCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { + i := a + j := b - 1 + for i < j { + data[i], data[j] = data[j], data[i] + i++ + j-- + } +} + +func swapRangeCmpFunc[E any](data []E, a, b, n int, cmp func(a, b E) int) { + for i := 0; i < n; i++ { + data[a+i], data[b+i] = data[b+i], data[a+i] + } +} + +func stableCmpFunc[E any](data []E, n int, cmp func(a, b E) int) { + blockSize := 20 // must be > 0 + a, b := 0, blockSize + for b <= n { + insertionSortCmpFunc(data, a, b, cmp) + a = b + b += blockSize + } + insertionSortCmpFunc(data, a, n, cmp) + + for blockSize < n { + a, b = 0, 2*blockSize + for b <= n { + symMergeCmpFunc(data, a, a+blockSize, b, cmp) + a = b + b += 2 * blockSize + } + if m := a + blockSize; m < n { + symMergeCmpFunc(data, a, m, n, cmp) + } + blockSize *= 2 + } +} + +// symMergeCmpFunc merges the two sorted subsequences data[a:m] and data[m:b] using +// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum +// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz +// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in +// Computer Science, pages 714-723. Springer, 2004. +// +// Let M = m-a and N = b-n. Wolog M < N. +// The recursion depth is bound by ceil(log(N+M)). +// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. +// The algorithm needs O((M+N)*log(M)) calls to data.Swap. +// +// The paper gives O((M+N)*log(M)) as the number of assignments assuming a +// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation +// in the paper carries through for Swap operations, especially as the block +// swapping rotate uses only O(M+N) Swaps. +// +// symMerge assumes non-degenerate arguments: a < m && m < b. +// Having the caller check this condition eliminates many leaf recursion calls, +// which improves performance. +func symMergeCmpFunc[E any](data []E, a, m, b int, cmp func(a, b E) int) { + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[a] into data[m:b] + // if data[a:m] only contains one element. + if m-a == 1 { + // Use binary search to find the lowest index i + // such that data[i] >= data[a] for m <= i < b. + // Exit the search loop with i == b in case no such index exists. + i := m + j := b + for i < j { + h := int(uint(i+j) >> 1) + if cmp(data[h], data[a]) < 0 { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[a] reaches the position before i. + for k := a; k < i-1; k++ { + data[k], data[k+1] = data[k+1], data[k] + } + return + } + + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[m] into data[a:m] + // if data[m:b] only contains one element. + if b-m == 1 { + // Use binary search to find the lowest index i + // such that data[i] > data[m] for a <= i < m. + // Exit the search loop with i == m in case no such index exists. + i := a + j := m + for i < j { + h := int(uint(i+j) >> 1) + if !(cmp(data[m], data[h]) < 0) { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[m] reaches the position i. + for k := m; k > i; k-- { + data[k], data[k-1] = data[k-1], data[k] + } + return + } + + mid := int(uint(a+b) >> 1) + n := mid + m + var start, r int + if m > mid { + start = n - b + r = mid + } else { + start = a + r = m + } + p := n - 1 + + for start < r { + c := int(uint(start+r) >> 1) + if !(cmp(data[p-c], data[c]) < 0) { + start = c + 1 + } else { + r = c + } + } + + end := n - start + if start < m && m < end { + rotateCmpFunc(data, start, m, end, cmp) + } + if a < start && start < mid { + symMergeCmpFunc(data, a, start, mid, cmp) + } + if mid < end && end < b { + symMergeCmpFunc(data, mid, end, b, cmp) + } +} + +// rotateCmpFunc rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: +// Data of the form 'x u v y' is changed to 'x v u y'. +// rotate performs at most b-a many calls to data.Swap, +// and it assumes non-degenerate arguments: a < m && m < b. +func rotateCmpFunc[E any](data []E, a, m, b int, cmp func(a, b E) int) { + i := m - a + j := b - m + + for i != j { + if i > j { + swapRangeCmpFunc(data, m-i, m, j, cmp) + i -= j + } else { + swapRangeCmpFunc(data, m-i, m+j-i, i, cmp) + j -= i + } + } + // i == j + swapRangeCmpFunc(data, m-i, m, i, cmp) +} diff --git a/vendor/golang.org/x/exp/slices/zsortordered.go b/vendor/golang.org/x/exp/slices/zsortordered.go new file mode 100644 index 0000000..99b47c3 --- /dev/null +++ b/vendor/golang.org/x/exp/slices/zsortordered.go @@ -0,0 +1,481 @@ +// Code generated by gen_sort_variants.go; DO NOT EDIT. + +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package slices + +import "golang.org/x/exp/constraints" + +// insertionSortOrdered sorts data[a:b] using insertion sort. +func insertionSortOrdered[E constraints.Ordered](data []E, a, b int) { + for i := a + 1; i < b; i++ { + for j := i; j > a && cmpLess(data[j], data[j-1]); j-- { + data[j], data[j-1] = data[j-1], data[j] + } + } +} + +// siftDownOrdered implements the heap property on data[lo:hi]. +// first is an offset into the array where the root of the heap lies. +func siftDownOrdered[E constraints.Ordered](data []E, lo, hi, first int) { + root := lo + for { + child := 2*root + 1 + if child >= hi { + break + } + if child+1 < hi && cmpLess(data[first+child], data[first+child+1]) { + child++ + } + if !cmpLess(data[first+root], data[first+child]) { + return + } + data[first+root], data[first+child] = data[first+child], data[first+root] + root = child + } +} + +func heapSortOrdered[E constraints.Ordered](data []E, a, b int) { + first := a + lo := 0 + hi := b - a + + // Build heap with greatest element at top. + for i := (hi - 1) / 2; i >= 0; i-- { + siftDownOrdered(data, i, hi, first) + } + + // Pop elements, largest first, into end of data. + for i := hi - 1; i >= 0; i-- { + data[first], data[first+i] = data[first+i], data[first] + siftDownOrdered(data, lo, i, first) + } +} + +// pdqsortOrdered sorts data[a:b]. +// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. +// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf +// C++ implementation: https://github.com/orlp/pdqsort +// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ +// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. +func pdqsortOrdered[E constraints.Ordered](data []E, a, b, limit int) { + const maxInsertion = 12 + + var ( + wasBalanced = true // whether the last partitioning was reasonably balanced + wasPartitioned = true // whether the slice was already partitioned + ) + + for { + length := b - a + + if length <= maxInsertion { + insertionSortOrdered(data, a, b) + return + } + + // Fall back to heapsort if too many bad choices were made. + if limit == 0 { + heapSortOrdered(data, a, b) + return + } + + // If the last partitioning was imbalanced, we need to breaking patterns. + if !wasBalanced { + breakPatternsOrdered(data, a, b) + limit-- + } + + pivot, hint := choosePivotOrdered(data, a, b) + if hint == decreasingHint { + reverseRangeOrdered(data, a, b) + // The chosen pivot was pivot-a elements after the start of the array. + // After reversing it is pivot-a elements before the end of the array. + // The idea came from Rust's implementation. + pivot = (b - 1) - (pivot - a) + hint = increasingHint + } + + // The slice is likely already sorted. + if wasBalanced && wasPartitioned && hint == increasingHint { + if partialInsertionSortOrdered(data, a, b) { + return + } + } + + // Probably the slice contains many duplicate elements, partition the slice into + // elements equal to and elements greater than the pivot. + if a > 0 && !cmpLess(data[a-1], data[pivot]) { + mid := partitionEqualOrdered(data, a, b, pivot) + a = mid + continue + } + + mid, alreadyPartitioned := partitionOrdered(data, a, b, pivot) + wasPartitioned = alreadyPartitioned + + leftLen, rightLen := mid-a, b-mid + balanceThreshold := length / 8 + if leftLen < rightLen { + wasBalanced = leftLen >= balanceThreshold + pdqsortOrdered(data, a, mid, limit) + a = mid + 1 + } else { + wasBalanced = rightLen >= balanceThreshold + pdqsortOrdered(data, mid+1, b, limit) + b = mid + } + } +} + +// partitionOrdered does one quicksort partition. +// Let p = data[pivot] +// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. +// On return, data[newpivot] = p +func partitionOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int, alreadyPartitioned bool) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for i <= j && cmpLess(data[i], data[a]) { + i++ + } + for i <= j && !cmpLess(data[j], data[a]) { + j-- + } + if i > j { + data[j], data[a] = data[a], data[j] + return j, true + } + data[i], data[j] = data[j], data[i] + i++ + j-- + + for { + for i <= j && cmpLess(data[i], data[a]) { + i++ + } + for i <= j && !cmpLess(data[j], data[a]) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + data[j], data[a] = data[a], data[j] + return j, false +} + +// partitionEqualOrdered partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. +// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. +func partitionEqualOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for { + for i <= j && !cmpLess(data[a], data[i]) { + i++ + } + for i <= j && cmpLess(data[a], data[j]) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + return i +} + +// partialInsertionSortOrdered partially sorts a slice, returns true if the slice is sorted at the end. +func partialInsertionSortOrdered[E constraints.Ordered](data []E, a, b int) bool { + const ( + maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted + shortestShifting = 50 // don't shift any elements on short arrays + ) + i := a + 1 + for j := 0; j < maxSteps; j++ { + for i < b && !cmpLess(data[i], data[i-1]) { + i++ + } + + if i == b { + return true + } + + if b-a < shortestShifting { + return false + } + + data[i], data[i-1] = data[i-1], data[i] + + // Shift the smaller one to the left. + if i-a >= 2 { + for j := i - 1; j >= 1; j-- { + if !cmpLess(data[j], data[j-1]) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + // Shift the greater one to the right. + if b-i >= 2 { + for j := i + 1; j < b; j++ { + if !cmpLess(data[j], data[j-1]) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + } + return false +} + +// breakPatternsOrdered scatters some elements around in an attempt to break some patterns +// that might cause imbalanced partitions in quicksort. +func breakPatternsOrdered[E constraints.Ordered](data []E, a, b int) { + length := b - a + if length >= 8 { + random := xorshift(length) + modulus := nextPowerOfTwo(length) + + for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { + other := int(uint(random.Next()) & (modulus - 1)) + if other >= length { + other -= length + } + data[idx], data[a+other] = data[a+other], data[idx] + } + } +} + +// choosePivotOrdered chooses a pivot in data[a:b]. +// +// [0,8): chooses a static pivot. +// [8,shortestNinther): uses the simple median-of-three method. +// [shortestNinther,∞): uses the Tukey ninther method. +func choosePivotOrdered[E constraints.Ordered](data []E, a, b int) (pivot int, hint sortedHint) { + const ( + shortestNinther = 50 + maxSwaps = 4 * 3 + ) + + l := b - a + + var ( + swaps int + i = a + l/4*1 + j = a + l/4*2 + k = a + l/4*3 + ) + + if l >= 8 { + if l >= shortestNinther { + // Tukey ninther method, the idea came from Rust's implementation. + i = medianAdjacentOrdered(data, i, &swaps) + j = medianAdjacentOrdered(data, j, &swaps) + k = medianAdjacentOrdered(data, k, &swaps) + } + // Find the median among i, j, k and stores it into j. + j = medianOrdered(data, i, j, k, &swaps) + } + + switch swaps { + case 0: + return j, increasingHint + case maxSwaps: + return j, decreasingHint + default: + return j, unknownHint + } +} + +// order2Ordered returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. +func order2Ordered[E constraints.Ordered](data []E, a, b int, swaps *int) (int, int) { + if cmpLess(data[b], data[a]) { + *swaps++ + return b, a + } + return a, b +} + +// medianOrdered returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. +func medianOrdered[E constraints.Ordered](data []E, a, b, c int, swaps *int) int { + a, b = order2Ordered(data, a, b, swaps) + b, c = order2Ordered(data, b, c, swaps) + a, b = order2Ordered(data, a, b, swaps) + return b +} + +// medianAdjacentOrdered finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. +func medianAdjacentOrdered[E constraints.Ordered](data []E, a int, swaps *int) int { + return medianOrdered(data, a-1, a, a+1, swaps) +} + +func reverseRangeOrdered[E constraints.Ordered](data []E, a, b int) { + i := a + j := b - 1 + for i < j { + data[i], data[j] = data[j], data[i] + i++ + j-- + } +} + +func swapRangeOrdered[E constraints.Ordered](data []E, a, b, n int) { + for i := 0; i < n; i++ { + data[a+i], data[b+i] = data[b+i], data[a+i] + } +} + +func stableOrdered[E constraints.Ordered](data []E, n int) { + blockSize := 20 // must be > 0 + a, b := 0, blockSize + for b <= n { + insertionSortOrdered(data, a, b) + a = b + b += blockSize + } + insertionSortOrdered(data, a, n) + + for blockSize < n { + a, b = 0, 2*blockSize + for b <= n { + symMergeOrdered(data, a, a+blockSize, b) + a = b + b += 2 * blockSize + } + if m := a + blockSize; m < n { + symMergeOrdered(data, a, m, n) + } + blockSize *= 2 + } +} + +// symMergeOrdered merges the two sorted subsequences data[a:m] and data[m:b] using +// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum +// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz +// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in +// Computer Science, pages 714-723. Springer, 2004. +// +// Let M = m-a and N = b-n. Wolog M < N. +// The recursion depth is bound by ceil(log(N+M)). +// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. +// The algorithm needs O((M+N)*log(M)) calls to data.Swap. +// +// The paper gives O((M+N)*log(M)) as the number of assignments assuming a +// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation +// in the paper carries through for Swap operations, especially as the block +// swapping rotate uses only O(M+N) Swaps. +// +// symMerge assumes non-degenerate arguments: a < m && m < b. +// Having the caller check this condition eliminates many leaf recursion calls, +// which improves performance. +func symMergeOrdered[E constraints.Ordered](data []E, a, m, b int) { + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[a] into data[m:b] + // if data[a:m] only contains one element. + if m-a == 1 { + // Use binary search to find the lowest index i + // such that data[i] >= data[a] for m <= i < b. + // Exit the search loop with i == b in case no such index exists. + i := m + j := b + for i < j { + h := int(uint(i+j) >> 1) + if cmpLess(data[h], data[a]) { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[a] reaches the position before i. + for k := a; k < i-1; k++ { + data[k], data[k+1] = data[k+1], data[k] + } + return + } + + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[m] into data[a:m] + // if data[m:b] only contains one element. + if b-m == 1 { + // Use binary search to find the lowest index i + // such that data[i] > data[m] for a <= i < m. + // Exit the search loop with i == m in case no such index exists. + i := a + j := m + for i < j { + h := int(uint(i+j) >> 1) + if !cmpLess(data[m], data[h]) { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[m] reaches the position i. + for k := m; k > i; k-- { + data[k], data[k-1] = data[k-1], data[k] + } + return + } + + mid := int(uint(a+b) >> 1) + n := mid + m + var start, r int + if m > mid { + start = n - b + r = mid + } else { + start = a + r = m + } + p := n - 1 + + for start < r { + c := int(uint(start+r) >> 1) + if !cmpLess(data[p-c], data[c]) { + start = c + 1 + } else { + r = c + } + } + + end := n - start + if start < m && m < end { + rotateOrdered(data, start, m, end) + } + if a < start && start < mid { + symMergeOrdered(data, a, start, mid) + } + if mid < end && end < b { + symMergeOrdered(data, mid, end, b) + } +} + +// rotateOrdered rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: +// Data of the form 'x u v y' is changed to 'x v u y'. +// rotate performs at most b-a many calls to data.Swap, +// and it assumes non-degenerate arguments: a < m && m < b. +func rotateOrdered[E constraints.Ordered](data []E, a, m, b int) { + i := m - a + j := b - m + + for i != j { + if i > j { + swapRangeOrdered(data, m-i, m, j) + i -= j + } else { + swapRangeOrdered(data, m-i, m+j-i, i) + j -= i + } + } + // i == j + swapRangeOrdered(data, m-i, m, i) +} diff --git a/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go b/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go index 2681af3..150f887 100644 --- a/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go +++ b/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go @@ -13,7 +13,7 @@ import ( "sync" ) -// Regexp is a wrapper around regexp.Regexp, where the underlying regexp will be +// Regexp is a wrapper around [regexp.Regexp], where the underlying regexp will be // compiled the first time it is needed. type Regexp struct { str string diff --git a/vendor/golang.org/x/mod/module/module.go b/vendor/golang.org/x/mod/module/module.go index e9dec6e..2a364b2 100644 --- a/vendor/golang.org/x/mod/module/module.go +++ b/vendor/golang.org/x/mod/module/module.go @@ -4,7 +4,7 @@ // Package module defines the module.Version type along with support code. // -// The module.Version type is a simple Path, Version pair: +// The [module.Version] type is a simple Path, Version pair: // // type Version struct { // Path string @@ -12,7 +12,7 @@ // } // // There are no restrictions imposed directly by use of this structure, -// but additional checking functions, most notably Check, verify that +// but additional checking functions, most notably [Check], verify that // a particular path, version pair is valid. // // # Escaped Paths @@ -140,7 +140,7 @@ type ModuleError struct { Err error } -// VersionError returns a ModuleError derived from a Version and error, +// VersionError returns a [ModuleError] derived from a [Version] and error, // or err itself if it is already such an error. func VersionError(v Version, err error) error { var mErr *ModuleError @@ -169,7 +169,7 @@ func (e *ModuleError) Unwrap() error { return e.Err } // An InvalidVersionError indicates an error specific to a version, with the // module path unknown or specified externally. // -// A ModuleError may wrap an InvalidVersionError, but an InvalidVersionError +// A [ModuleError] may wrap an InvalidVersionError, but an InvalidVersionError // must not wrap a ModuleError. type InvalidVersionError struct { Version string @@ -193,8 +193,8 @@ func (e *InvalidVersionError) Error() string { func (e *InvalidVersionError) Unwrap() error { return e.Err } // An InvalidPathError indicates a module, import, or file path doesn't -// satisfy all naming constraints. See CheckPath, CheckImportPath, -// and CheckFilePath for specific restrictions. +// satisfy all naming constraints. See [CheckPath], [CheckImportPath], +// and [CheckFilePath] for specific restrictions. type InvalidPathError struct { Kind string // "module", "import", or "file" Path string @@ -294,7 +294,7 @@ func fileNameOK(r rune) bool { } // CheckPath checks that a module path is valid. -// A valid module path is a valid import path, as checked by CheckImportPath, +// A valid module path is a valid import path, as checked by [CheckImportPath], // with three additional constraints. // First, the leading path element (up to the first slash, if any), // by convention a domain name, must contain only lower-case ASCII letters, @@ -380,7 +380,7 @@ const ( // checkPath returns an error describing why the path is not valid. // Because these checks apply to module, import, and file paths, // and because other checks may be applied, the caller is expected to wrap -// this error with InvalidPathError. +// this error with [InvalidPathError]. func checkPath(path string, kind pathKind) error { if !utf8.ValidString(path) { return fmt.Errorf("invalid UTF-8") @@ -532,7 +532,7 @@ var badWindowsNames = []string{ // they require ".vN" instead of "/vN", and for all N, not just N >= 2. // SplitPathVersion returns with ok = false when presented with // a path whose last path element does not satisfy the constraints -// applied by CheckPath, such as "example.com/pkg/v1" or "example.com/pkg/v1.2". +// applied by [CheckPath], such as "example.com/pkg/v1" or "example.com/pkg/v1.2". func SplitPathVersion(path string) (prefix, pathMajor string, ok bool) { if strings.HasPrefix(path, "gopkg.in/") { return splitGopkgIn(path) @@ -582,7 +582,7 @@ func splitGopkgIn(path string) (prefix, pathMajor string, ok bool) { // MatchPathMajor reports whether the semantic version v // matches the path major version pathMajor. // -// MatchPathMajor returns true if and only if CheckPathMajor returns nil. +// MatchPathMajor returns true if and only if [CheckPathMajor] returns nil. func MatchPathMajor(v, pathMajor string) bool { return CheckPathMajor(v, pathMajor) == nil } @@ -622,7 +622,7 @@ func CheckPathMajor(v, pathMajor string) error { // PathMajorPrefix returns the major-version tag prefix implied by pathMajor. // An empty PathMajorPrefix allows either v0 or v1. // -// Note that MatchPathMajor may accept some versions that do not actually begin +// Note that [MatchPathMajor] may accept some versions that do not actually begin // with this prefix: namely, it accepts a 'v0.0.0-' prefix for a '.v1' // pathMajor, even though that pathMajor implies 'v1' tagging. func PathMajorPrefix(pathMajor string) string { @@ -643,7 +643,7 @@ func PathMajorPrefix(pathMajor string) string { } // CanonicalVersion returns the canonical form of the version string v. -// It is the same as semver.Canonical(v) except that it preserves the special build suffix "+incompatible". +// It is the same as [semver.Canonical] except that it preserves the special build suffix "+incompatible". func CanonicalVersion(v string) string { cv := semver.Canonical(v) if semver.Build(v) == "+incompatible" { @@ -652,8 +652,8 @@ func CanonicalVersion(v string) string { return cv } -// Sort sorts the list by Path, breaking ties by comparing Version fields. -// The Version fields are interpreted as semantic versions (using semver.Compare) +// Sort sorts the list by Path, breaking ties by comparing [Version] fields. +// The Version fields are interpreted as semantic versions (using [semver.Compare]) // optionally followed by a tie-breaking suffix introduced by a slash character, // like in "v0.0.1/go.mod". func Sort(list []Version) { @@ -793,7 +793,7 @@ func unescapeString(escaped string) (string, bool) { } // MatchPrefixPatterns reports whether any path prefix of target matches one of -// the glob patterns (as defined by path.Match) in the comma-separated globs +// the glob patterns (as defined by [path.Match]) in the comma-separated globs // list. This implements the algorithm used when matching a module path to the // GOPRIVATE environment variable, as described by 'go help module-private'. // diff --git a/vendor/golang.org/x/mod/module/pseudo.go b/vendor/golang.org/x/mod/module/pseudo.go index f04ad37..9cf19d3 100644 --- a/vendor/golang.org/x/mod/module/pseudo.go +++ b/vendor/golang.org/x/mod/module/pseudo.go @@ -125,7 +125,7 @@ func IsPseudoVersion(v string) bool { } // IsZeroPseudoVersion returns whether v is a pseudo-version with a zero base, -// timestamp, and revision, as returned by ZeroPseudoVersion. +// timestamp, and revision, as returned by [ZeroPseudoVersion]. func IsZeroPseudoVersion(v string) bool { return v == ZeroPseudoVersion(semver.Major(v)) } diff --git a/vendor/golang.org/x/mod/semver/semver.go b/vendor/golang.org/x/mod/semver/semver.go index a30a22b..9a2dfd3 100644 --- a/vendor/golang.org/x/mod/semver/semver.go +++ b/vendor/golang.org/x/mod/semver/semver.go @@ -140,7 +140,7 @@ func Compare(v, w string) int { // Max canonicalizes its arguments and then returns the version string // that compares greater. // -// Deprecated: use Compare instead. In most cases, returning a canonicalized +// Deprecated: use [Compare] instead. In most cases, returning a canonicalized // version is not expected or desired. func Max(v, w string) string { v = Canonical(v) @@ -151,7 +151,7 @@ func Max(v, w string) string { return w } -// ByVersion implements sort.Interface for sorting semantic version strings. +// ByVersion implements [sort.Interface] for sorting semantic version strings. type ByVersion []string func (vs ByVersion) Len() int { return len(vs) } @@ -164,7 +164,7 @@ func (vs ByVersion) Less(i, j int) bool { return vs[i] < vs[j] } -// Sort sorts a list of semantic version strings using ByVersion. +// Sort sorts a list of semantic version strings using [ByVersion]. func Sort(list []string) { sort.Sort(ByVersion(list)) } diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go index 8b28031..e8c1233 100644 --- a/vendor/golang.org/x/net/html/render.go +++ b/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index 5c2a1f4..de67f93 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index 8f775fa..47fa6a7 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -583,6 +583,7 @@ ccflags="$@" $2 ~ /^PERF_/ || $2 ~ /^SECCOMP_MODE_/ || $2 ~ /^SEEK_/ || + $2 ~ /^SCHED_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || $2 !~ /IOC_MAGIC/ && diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index a730878..0ba0301 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -2471,6 +2471,29 @@ func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask * return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) } +//sys schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) +//sys schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) + +// SchedSetAttr is a wrapper for sched_setattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_setattr.2.html +func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error { + if attr == nil { + return EINVAL + } + attr.Size = SizeofSchedAttr + return schedSetattr(pid, attr, flags) +} + +// SchedGetAttr is a wrapper for sched_getattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_getattr.2.html +func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) { + attr := &SchedAttr{} + if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil { + return nil, err + } + return attr, nil +} + /* * Unimplemented */ diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 8bb30e7..f6eda27 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -549,6 +549,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) { if err != nil { return err } + if (flag&O_NONBLOCK != 0) == nonblocking { + return nil + } if nonblocking { flag |= O_NONBLOCK } else { diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 3784f40..0787a04 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -2821,6 +2821,23 @@ const ( RWF_SUPPORTED = 0x1f RWF_SYNC = 0x4 RWF_WRITE_LIFE_NOT_SET = 0x0 + SCHED_BATCH = 0x3 + SCHED_DEADLINE = 0x6 + SCHED_FIFO = 0x1 + SCHED_FLAG_ALL = 0x7f + SCHED_FLAG_DL_OVERRUN = 0x4 + SCHED_FLAG_KEEP_ALL = 0x18 + SCHED_FLAG_KEEP_PARAMS = 0x10 + SCHED_FLAG_KEEP_POLICY = 0x8 + SCHED_FLAG_RECLAIM = 0x2 + SCHED_FLAG_RESET_ON_FORK = 0x1 + SCHED_FLAG_UTIL_CLAMP = 0x60 + SCHED_FLAG_UTIL_CLAMP_MAX = 0x40 + SCHED_FLAG_UTIL_CLAMP_MIN = 0x20 + SCHED_IDLE = 0x5 + SCHED_NORMAL = 0x0 + SCHED_RESET_ON_FORK = 0x40000000 + SCHED_RR = 0x2 SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x1d diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index a07321b..14ab34a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -2197,3 +2197,23 @@ func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) { + _, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index 26ef52a..494493c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -5868,3 +5868,18 @@ const ( VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 VIRTIO_NET_HDR_GSO_ECN = 0x80 ) + +type SchedAttr struct { + Size uint32 + Policy uint32 + Flags uint64 + Nice int32 + Priority uint32 + Runtime uint64 + Deadline uint64 + Period uint64 + Util_min uint32 + Util_max uint32 +} + +const SizeofSchedAttr = 0x38 diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 373d163..67bad09 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -216,7 +216,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys shGetKnownFolderPath(id *KNOWNFOLDERID, flags uint32, token Token, path **uint16) (ret error) = shell32.SHGetKnownFolderPath //sys TerminateProcess(handle Handle, exitcode uint32) (err error) //sys GetExitCodeProcess(handle Handle, exitcode *uint32) (err error) -//sys GetStartupInfo(startupInfo *StartupInfo) (err error) = GetStartupInfoW +//sys getStartupInfo(startupInfo *StartupInfo) = GetStartupInfoW //sys GetProcessTimes(handle Handle, creationTime *Filetime, exitTime *Filetime, kernelTime *Filetime, userTime *Filetime) (err error) //sys DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error) //sys WaitForSingleObject(handle Handle, waitMilliseconds uint32) (event uint32, err error) [failretval==0xffffffff] @@ -437,6 +437,10 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute //sys DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute +// Windows Multimedia API +//sys TimeBeginPeriod (period uint32) (err error) [failretval != 0] = winmm.timeBeginPeriod +//sys TimeEndPeriod (period uint32) (err error) [failretval != 0] = winmm.timeEndPeriod + // syscall interface implementation for other packages // GetCurrentProcess returns the handle for the current process. @@ -1624,6 +1628,11 @@ func SetConsoleCursorPosition(console Handle, position Coord) error { return setConsoleCursorPosition(console, *((*uint32)(unsafe.Pointer(&position)))) } +func GetStartupInfo(startupInfo *StartupInfo) error { + getStartupInfo(startupInfo) + return nil +} + func (s NTStatus) Errno() syscall.Errno { return rtlNtStatusToDosErrorNoTeb(s) } diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 566dd3e..5c38558 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -55,6 +55,7 @@ var ( moduser32 = NewLazySystemDLL("user32.dll") moduserenv = NewLazySystemDLL("userenv.dll") modversion = NewLazySystemDLL("version.dll") + modwinmm = NewLazySystemDLL("winmm.dll") modwintrust = NewLazySystemDLL("wintrust.dll") modws2_32 = NewLazySystemDLL("ws2_32.dll") modwtsapi32 = NewLazySystemDLL("wtsapi32.dll") @@ -468,6 +469,8 @@ var ( procGetFileVersionInfoSizeW = modversion.NewProc("GetFileVersionInfoSizeW") procGetFileVersionInfoW = modversion.NewProc("GetFileVersionInfoW") procVerQueryValueW = modversion.NewProc("VerQueryValueW") + proctimeBeginPeriod = modwinmm.NewProc("timeBeginPeriod") + proctimeEndPeriod = modwinmm.NewProc("timeEndPeriod") procWinVerifyTrustEx = modwintrust.NewProc("WinVerifyTrustEx") procFreeAddrInfoW = modws2_32.NewProc("FreeAddrInfoW") procGetAddrInfoW = modws2_32.NewProc("GetAddrInfoW") @@ -2367,11 +2370,8 @@ func GetShortPathName(longpath *uint16, shortpath *uint16, buflen uint32) (n uin return } -func GetStartupInfo(startupInfo *StartupInfo) (err error) { - r1, _, e1 := syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) - if r1 == 0 { - err = errnoErr(e1) - } +func getStartupInfo(startupInfo *StartupInfo) { + syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) return } @@ -4017,6 +4017,22 @@ func _VerQueryValue(block unsafe.Pointer, subBlock *uint16, pointerToBufferPoint return } +func TimeBeginPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeBeginPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + +func TimeEndPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeEndPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + func WinVerifyTrustEx(hwnd HWND, actionId *GUID, data *WinTrustData) (ret error) { r0, _, _ := syscall.Syscall(procWinVerifyTrustEx.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(actionId)), uintptr(unsafe.Pointer(data))) if r0 != 0 { diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de..a09ed19 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b583..14167e7 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f49..1153baf 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b..a6573dc 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go index 165ede0..03543bd 100644 --- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go +++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go @@ -128,15 +128,14 @@ func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package, // (from "version"). Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'i': - _, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path) - return pkg, err + case 'v', 'c', 'd': // binary, till go1.10 + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) - case 'v', 'c', 'd': - _, pkg, err := gcimporter.BImportData(fset, imports, data, path) + case 'i': // indexed, till go1.19 + _, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path) return pkg, err - case 'u': + case 'u': // unified, from go1.20 _, pkg, err := gcimporter.UImportData(fset, imports, data[1:], path) return pkg, err diff --git a/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go b/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go index 18a002f..0454cdd 100644 --- a/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go +++ b/vendor/golang.org/x/tools/go/internal/packagesdriver/sizes.go @@ -8,7 +8,6 @@ package packagesdriver import ( "context" "fmt" - "go/types" "strings" "golang.org/x/tools/internal/gocommand" @@ -16,7 +15,7 @@ import ( var debug = false -func GetSizesGolist(ctx context.Context, inv gocommand.Invocation, gocmdRunner *gocommand.Runner) (types.Sizes, error) { +func GetSizesForArgsGolist(ctx context.Context, inv gocommand.Invocation, gocmdRunner *gocommand.Runner) (string, string, error) { inv.Verb = "list" inv.Args = []string{"-f", "{{context.GOARCH}} {{context.Compiler}}", "--", "unsafe"} stdout, stderr, friendlyErr, rawErr := gocmdRunner.RunRaw(ctx, inv) @@ -29,21 +28,21 @@ func GetSizesGolist(ctx context.Context, inv gocommand.Invocation, gocmdRunner * inv.Args = []string{"GOARCH"} envout, enverr := gocmdRunner.Run(ctx, inv) if enverr != nil { - return nil, enverr + return "", "", enverr } goarch = strings.TrimSpace(envout.String()) compiler = "gc" } else { - return nil, friendlyErr + return "", "", friendlyErr } } else { fields := strings.Fields(stdout.String()) if len(fields) < 2 { - return nil, fmt.Errorf("could not parse GOARCH and Go compiler in format \" \":\nstdout: <<%s>>\nstderr: <<%s>>", + return "", "", fmt.Errorf("could not parse GOARCH and Go compiler in format \" \":\nstdout: <<%s>>\nstderr: <<%s>>", stdout.String(), stderr.String()) } goarch = fields[0] compiler = fields[1] } - return types.SizesFor(compiler, goarch), nil + return compiler, goarch, nil } diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go index 6bb7168..b5de9cf 100644 --- a/vendor/golang.org/x/tools/go/packages/golist.go +++ b/vendor/golang.org/x/tools/go/packages/golist.go @@ -9,7 +9,6 @@ import ( "context" "encoding/json" "fmt" - "go/types" "io/ioutil" "log" "os" @@ -153,10 +152,10 @@ func goListDriver(cfg *Config, patterns ...string) (*driverResponse, error) { if cfg.Mode&NeedTypesSizes != 0 || cfg.Mode&NeedTypes != 0 { sizeswg.Add(1) go func() { - var sizes types.Sizes - sizes, sizeserr = packagesdriver.GetSizesGolist(ctx, state.cfgInvocation(), cfg.gocmdRunner) - // types.SizesFor always returns nil or a *types.StdSizes. - response.dr.Sizes, _ = sizes.(*types.StdSizes) + compiler, arch, err := packagesdriver.GetSizesForArgsGolist(ctx, state.cfgInvocation(), cfg.gocmdRunner) + sizeserr = err + response.dr.Compiler = compiler + response.dr.Arch = arch sizeswg.Done() }() } @@ -625,7 +624,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse } if pkg.PkgPath == "unsafe" { - pkg.GoFiles = nil // ignore fake unsafe.go file + pkg.CompiledGoFiles = nil // ignore fake unsafe.go file (#59929) + } else if len(pkg.CompiledGoFiles) == 0 { + // Work around for pre-go.1.11 versions of go list. + // TODO(matloob): they should be handled by the fallback. + // Can we delete this? + pkg.CompiledGoFiles = pkg.GoFiles } // Assume go list emits only absolute paths for Dir. @@ -663,16 +667,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse response.Roots = append(response.Roots, pkg.ID) } - // Work around for pre-go.1.11 versions of go list. - // TODO(matloob): they should be handled by the fallback. - // Can we delete this? - if len(pkg.CompiledGoFiles) == 0 { - pkg.CompiledGoFiles = pkg.GoFiles - } - // Temporary work-around for golang/go#39986. Parse filenames out of // error messages. This happens if there are unrecoverable syntax // errors in the source, so we can't match on a specific error message. + // + // TODO(rfindley): remove this heuristic, in favor of considering + // InvalidGoFiles from the list driver. if err := p.Error; err != nil && state.shouldAddFilenameFromError(p) { addFilenameFromPos := func(pos string) bool { split := strings.Split(pos, ":") @@ -891,6 +891,15 @@ func golistargs(cfg *Config, words []string, goVersion int) []string { // probably because you'd just get the TestMain. fmt.Sprintf("-find=%t", !cfg.Tests && cfg.Mode&findFlags == 0 && !usesExportData(cfg)), } + + // golang/go#60456: with go1.21 and later, go list serves pgo variants, which + // can be costly to compute and may result in redundant processing for the + // caller. Disable these variants. If someone wants to add e.g. a NeedPGO + // mode flag, that should be a separate proposal. + if goVersion >= 21 { + fullargs = append(fullargs, "-pgo=off") + } + fullargs = append(fullargs, cfg.BuildFlags...) fullargs = append(fullargs, "--") fullargs = append(fullargs, words...) diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go index 0f1505b..124a6fe 100644 --- a/vendor/golang.org/x/tools/go/packages/packages.go +++ b/vendor/golang.org/x/tools/go/packages/packages.go @@ -220,8 +220,10 @@ type driverResponse struct { // lists of multiple drivers, go/packages will fall back to the next driver. NotHandled bool - // Sizes, if not nil, is the types.Sizes to use when type checking. - Sizes *types.StdSizes + // Compiler and Arch are the arguments pass of types.SizesFor + // to get a types.Sizes to use when type checking. + Compiler string + Arch string // Roots is the set of package IDs that make up the root packages. // We have to encode this separately because when we encode a single package @@ -262,7 +264,7 @@ func Load(cfg *Config, patterns ...string) ([]*Package, error) { if err != nil { return nil, err } - l.sizes = response.Sizes + l.sizes = types.SizesFor(response.Compiler, response.Arch) return l.refine(response) } @@ -308,6 +310,9 @@ type Package struct { TypeErrors []types.Error // GoFiles lists the absolute file paths of the package's Go source files. + // It may include files that should not be compiled, for example because + // they contain non-matching build tags, are documentary pseudo-files such as + // unsafe/unsafe.go or builtin/builtin.go, or are subject to cgo preprocessing. GoFiles []string // CompiledGoFiles lists the absolute file paths of the package's source @@ -627,7 +632,7 @@ func newLoader(cfg *Config) *loader { return ld } -// refine connects the supplied packages into a graph and then adds type and +// refine connects the supplied packages into a graph and then adds type // and syntax information as requested by the LoadMode. func (ld *loader) refine(response *driverResponse) ([]*Package, error) { roots := response.Roots @@ -1040,6 +1045,9 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { Error: appendError, Sizes: ld.sizes, } + if lpkg.Module != nil && lpkg.Module.GoVersion != "" { + typesinternal.SetGoVersion(tc, "go"+lpkg.Module.GoVersion) + } if (ld.Mode & typecheckCgo) != 0 { if !typesinternal.SetUsesCgo(tc) { appendError(Error{ diff --git a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go new file mode 100644 index 0000000..fa5834b --- /dev/null +++ b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go @@ -0,0 +1,827 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package objectpath defines a naming scheme for types.Objects +// (that is, named entities in Go programs) relative to their enclosing +// package. +// +// Type-checker objects are canonical, so they are usually identified by +// their address in memory (a pointer), but a pointer has meaning only +// within one address space. By contrast, objectpath names allow the +// identity of an object to be sent from one program to another, +// establishing a correspondence between types.Object variables that are +// distinct but logically equivalent. +// +// A single object may have multiple paths. In this example, +// +// type A struct{ X int } +// type B A +// +// the field X has two paths due to its membership of both A and B. +// The For(obj) function always returns one of these paths, arbitrarily +// but consistently. +package objectpath + +import ( + "fmt" + "go/types" + "sort" + "strconv" + "strings" + _ "unsafe" + + "golang.org/x/tools/internal/typeparams" + "golang.org/x/tools/internal/typesinternal" +) + +// A Path is an opaque name that identifies a types.Object +// relative to its package. Conceptually, the name consists of a +// sequence of destructuring operations applied to the package scope +// to obtain the original object. +// The name does not include the package itself. +type Path string + +// Encoding +// +// An object path is a textual and (with training) human-readable encoding +// of a sequence of destructuring operators, starting from a types.Package. +// The sequences represent a path through the package/object/type graph. +// We classify these operators by their type: +// +// PO package->object Package.Scope.Lookup +// OT object->type Object.Type +// TT type->type Type.{Elem,Key,Params,Results,Underlying} [EKPRU] +// TO type->object Type.{At,Field,Method,Obj} [AFMO] +// +// All valid paths start with a package and end at an object +// and thus may be defined by the regular language: +// +// objectpath = PO (OT TT* TO)* +// +// The concrete encoding follows directly: +// - The only PO operator is Package.Scope.Lookup, which requires an identifier. +// - The only OT operator is Object.Type, +// which we encode as '.' because dot cannot appear in an identifier. +// - The TT operators are encoded as [EKPRUTC]; +// one of these (TypeParam) requires an integer operand, +// which is encoded as a string of decimal digits. +// - The TO operators are encoded as [AFMO]; +// three of these (At,Field,Method) require an integer operand, +// which is encoded as a string of decimal digits. +// These indices are stable across different representations +// of the same package, even source and export data. +// The indices used are implementation specific and may not correspond to +// the argument to the go/types function. +// +// In the example below, +// +// package p +// +// type T interface { +// f() (a string, b struct{ X int }) +// } +// +// field X has the path "T.UM0.RA1.F0", +// representing the following sequence of operations: +// +// p.Lookup("T") T +// .Type().Underlying().Method(0). f +// .Type().Results().At(1) b +// .Type().Field(0) X +// +// The encoding is not maximally compact---every R or P is +// followed by an A, for example---but this simplifies the +// encoder and decoder. +const ( + // object->type operators + opType = '.' // .Type() (Object) + + // type->type operators + opElem = 'E' // .Elem() (Pointer, Slice, Array, Chan, Map) + opKey = 'K' // .Key() (Map) + opParams = 'P' // .Params() (Signature) + opResults = 'R' // .Results() (Signature) + opUnderlying = 'U' // .Underlying() (Named) + opTypeParam = 'T' // .TypeParams.At(i) (Named, Signature) + opConstraint = 'C' // .Constraint() (TypeParam) + + // type->object operators + opAt = 'A' // .At(i) (Tuple) + opField = 'F' // .Field(i) (Struct) + opMethod = 'M' // .Method(i) (Named or Interface; not Struct: "promoted" names are ignored) + opObj = 'O' // .Obj() (Named, TypeParam) +) + +// For is equivalent to new(Encoder).For(obj). +// +// It may be more efficient to reuse a single Encoder across several calls. +func For(obj types.Object) (Path, error) { + return new(Encoder).For(obj) +} + +// An Encoder amortizes the cost of encoding the paths of multiple objects. +// The zero value of an Encoder is ready to use. +type Encoder struct { + scopeMemo map[*types.Scope][]types.Object // memoization of scopeObjects + namedMethodsMemo map[*types.Named][]*types.Func // memoization of namedMethods() + skipMethodSorting bool +} + +// Expose back doors so that gopls can avoid method sorting, which can dominate +// analysis on certain repositories. +// +// TODO(golang/go#61443): remove this. +func init() { + typesinternal.SkipEncoderMethodSorting = func(enc interface{}) { + enc.(*Encoder).skipMethodSorting = true + } + typesinternal.ObjectpathObject = object +} + +// For returns the path to an object relative to its package, +// or an error if the object is not accessible from the package's Scope. +// +// The For function guarantees to return a path only for the following objects: +// - package-level types +// - exported package-level non-types +// - methods +// - parameter and result variables +// - struct fields +// These objects are sufficient to define the API of their package. +// The objects described by a package's export data are drawn from this set. +// +// The set of objects accessible from a package's Scope depends on +// whether the package was produced by type-checking syntax, or +// reading export data; the latter may have a smaller Scope since +// export data trims objects that are not reachable from an exported +// declaration. For example, the For function will return a path for +// an exported method of an unexported type that is not reachable +// from any public declaration; this path will cause the Object +// function to fail if called on a package loaded from export data. +// TODO(adonovan): is this a bug or feature? Should this package +// compute accessibility in the same way? +// +// For does not return a path for predeclared names, imported package +// names, local names, and unexported package-level names (except +// types). +// +// Example: given this definition, +// +// package p +// +// type T interface { +// f() (a string, b struct{ X int }) +// } +// +// For(X) would return a path that denotes the following sequence of operations: +// +// p.Scope().Lookup("T") (TypeName T) +// .Type().Underlying().Method(0). (method Func f) +// .Type().Results().At(1) (field Var b) +// .Type().Field(0) (field Var X) +// +// where p is the package (*types.Package) to which X belongs. +func (enc *Encoder) For(obj types.Object) (Path, error) { + pkg := obj.Pkg() + + // This table lists the cases of interest. + // + // Object Action + // ------ ------ + // nil reject + // builtin reject + // pkgname reject + // label reject + // var + // package-level accept + // func param/result accept + // local reject + // struct field accept + // const + // package-level accept + // local reject + // func + // package-level accept + // init functions reject + // concrete method accept + // interface method accept + // type + // package-level accept + // local reject + // + // The only accessible package-level objects are members of pkg itself. + // + // The cases are handled in four steps: + // + // 1. reject nil and builtin + // 2. accept package-level objects + // 3. reject obviously invalid objects + // 4. search the API for the path to the param/result/field/method. + + // 1. reference to nil or builtin? + if pkg == nil { + return "", fmt.Errorf("predeclared %s has no path", obj) + } + scope := pkg.Scope() + + // 2. package-level object? + if scope.Lookup(obj.Name()) == obj { + // Only exported objects (and non-exported types) have a path. + // Non-exported types may be referenced by other objects. + if _, ok := obj.(*types.TypeName); !ok && !obj.Exported() { + return "", fmt.Errorf("no path for non-exported %v", obj) + } + return Path(obj.Name()), nil + } + + // 3. Not a package-level object. + // Reject obviously non-viable cases. + switch obj := obj.(type) { + case *types.TypeName: + if _, ok := obj.Type().(*typeparams.TypeParam); !ok { + // With the exception of type parameters, only package-level type names + // have a path. + return "", fmt.Errorf("no path for %v", obj) + } + case *types.Const, // Only package-level constants have a path. + *types.Label, // Labels are function-local. + *types.PkgName: // PkgNames are file-local. + return "", fmt.Errorf("no path for %v", obj) + + case *types.Var: + // Could be: + // - a field (obj.IsField()) + // - a func parameter or result + // - a local var. + // Sadly there is no way to distinguish + // a param/result from a local + // so we must proceed to the find. + + case *types.Func: + // A func, if not package-level, must be a method. + if recv := obj.Type().(*types.Signature).Recv(); recv == nil { + return "", fmt.Errorf("func is not a method: %v", obj) + } + + if path, ok := enc.concreteMethod(obj); ok { + // Fast path for concrete methods that avoids looping over scope. + return path, nil + } + + default: + panic(obj) + } + + // 4. Search the API for the path to the var (field/param/result) or method. + + // First inspect package-level named types. + // In the presence of path aliases, these give + // the best paths because non-types may + // refer to types, but not the reverse. + empty := make([]byte, 0, 48) // initial space + objs := enc.scopeObjects(scope) + for _, o := range objs { + tname, ok := o.(*types.TypeName) + if !ok { + continue // handle non-types in second pass + } + + path := append(empty, o.Name()...) + path = append(path, opType) + + T := o.Type() + + if tname.IsAlias() { + // type alias + if r := find(obj, T, path, nil); r != nil { + return Path(r), nil + } + } else { + if named, _ := T.(*types.Named); named != nil { + if r := findTypeParam(obj, typeparams.ForNamed(named), path, nil); r != nil { + // generic named type + return Path(r), nil + } + } + // defined (named) type + if r := find(obj, T.Underlying(), append(path, opUnderlying), nil); r != nil { + return Path(r), nil + } + } + } + + // Then inspect everything else: + // non-types, and declared methods of defined types. + for _, o := range objs { + path := append(empty, o.Name()...) + if _, ok := o.(*types.TypeName); !ok { + if o.Exported() { + // exported non-type (const, var, func) + if r := find(obj, o.Type(), append(path, opType), nil); r != nil { + return Path(r), nil + } + } + continue + } + + // Inspect declared methods of defined types. + if T, ok := o.Type().(*types.Named); ok { + path = append(path, opType) + if !enc.skipMethodSorting { + // Note that method index here is always with respect + // to canonical ordering of methods, regardless of how + // they appear in the underlying type. + for i, m := range enc.namedMethods(T) { + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return Path(path2), nil // found declared method + } + if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { + return Path(r), nil + } + } + } else { + // This branch must match the logic in the branch above, using go/types + // APIs without sorting. + for i := 0; i < T.NumMethods(); i++ { + m := T.Method(i) + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return Path(path2), nil // found declared method + } + if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { + return Path(r), nil + } + } + } + } + } + + return "", fmt.Errorf("can't find path for %v in %s", obj, pkg.Path()) +} + +func appendOpArg(path []byte, op byte, arg int) []byte { + path = append(path, op) + path = strconv.AppendInt(path, int64(arg), 10) + return path +} + +// concreteMethod returns the path for meth, which must have a non-nil receiver. +// The second return value indicates success and may be false if the method is +// an interface method or if it is an instantiated method. +// +// This function is just an optimization that avoids the general scope walking +// approach. You are expected to fall back to the general approach if this +// function fails. +func (enc *Encoder) concreteMethod(meth *types.Func) (Path, bool) { + // Concrete methods can only be declared on package-scoped named types. For + // that reason we can skip the expensive walk over the package scope: the + // path will always be package -> named type -> method. We can trivially get + // the type name from the receiver, and only have to look over the type's + // methods to find the method index. + // + // Methods on generic types require special consideration, however. Consider + // the following package: + // + // L1: type S[T any] struct{} + // L2: func (recv S[A]) Foo() { recv.Bar() } + // L3: func (recv S[B]) Bar() { } + // L4: type Alias = S[int] + // L5: func _[T any]() { var s S[int]; s.Foo() } + // + // The receivers of methods on generic types are instantiations. L2 and L3 + // instantiate S with the type-parameters A and B, which are scoped to the + // respective methods. L4 and L5 each instantiate S with int. Each of these + // instantiations has its own method set, full of methods (and thus objects) + // with receivers whose types are the respective instantiations. In other + // words, we have + // + // S[A].Foo, S[A].Bar + // S[B].Foo, S[B].Bar + // S[int].Foo, S[int].Bar + // + // We may thus be trying to produce object paths for any of these objects. + // + // S[A].Foo and S[B].Bar are the origin methods, and their paths are S.Foo + // and S.Bar, which are the paths that this function naturally produces. + // + // S[A].Bar, S[B].Foo, and both methods on S[int] are instantiations that + // don't correspond to the origin methods. For S[int], this is significant. + // The most precise object path for S[int].Foo, for example, is Alias.Foo, + // not S.Foo. Our function, however, would produce S.Foo, which would + // resolve to a different object. + // + // For S[A].Bar and S[B].Foo it could be argued that S.Bar and S.Foo are + // still the correct paths, since only the origin methods have meaningful + // paths. But this is likely only true for trivial cases and has edge cases. + // Since this function is only an optimization, we err on the side of giving + // up, deferring to the slower but definitely correct algorithm. Most users + // of objectpath will only be giving us origin methods, anyway, as referring + // to instantiated methods is usually not useful. + + if typeparams.OriginMethod(meth) != meth { + return "", false + } + + recvT := meth.Type().(*types.Signature).Recv().Type() + if ptr, ok := recvT.(*types.Pointer); ok { + recvT = ptr.Elem() + } + + named, ok := recvT.(*types.Named) + if !ok { + return "", false + } + + if types.IsInterface(named) { + // Named interfaces don't have to be package-scoped + // + // TODO(dominikh): opt: if scope.Lookup(name) == named, then we can apply this optimization to interface + // methods, too, I think. + return "", false + } + + // Preallocate space for the name, opType, opMethod, and some digits. + name := named.Obj().Name() + path := make([]byte, 0, len(name)+8) + path = append(path, name...) + path = append(path, opType) + + if !enc.skipMethodSorting { + for i, m := range enc.namedMethods(named) { + if m == meth { + path = appendOpArg(path, opMethod, i) + return Path(path), true + } + } + } else { + // This branch must match the logic of the branch above, using go/types + // APIs without sorting. + for i := 0; i < named.NumMethods(); i++ { + m := named.Method(i) + if m == meth { + path = appendOpArg(path, opMethod, i) + return Path(path), true + } + } + } + + // Due to golang/go#59944, go/types fails to associate the receiver with + // certain methods on cgo types. + // + // TODO(rfindley): replace this panic once golang/go#59944 is fixed in all Go + // versions gopls supports. + return "", false + // panic(fmt.Sprintf("couldn't find method %s on type %s; methods: %#v", meth, named, enc.namedMethods(named))) +} + +// find finds obj within type T, returning the path to it, or nil if not found. +// +// The seen map is used to short circuit cycles through type parameters. If +// nil, it will be allocated as necessary. +func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName]bool) []byte { + switch T := T.(type) { + case *types.Basic, *types.Named: + // Named types belonging to pkg were handled already, + // so T must belong to another package. No path. + return nil + case *types.Pointer: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Slice: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Array: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Chan: + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Map: + if r := find(obj, T.Key(), append(path, opKey), seen); r != nil { + return r + } + return find(obj, T.Elem(), append(path, opElem), seen) + case *types.Signature: + if r := findTypeParam(obj, typeparams.ForSignature(T), path, seen); r != nil { + return r + } + if r := find(obj, T.Params(), append(path, opParams), seen); r != nil { + return r + } + return find(obj, T.Results(), append(path, opResults), seen) + case *types.Struct: + for i := 0; i < T.NumFields(); i++ { + fld := T.Field(i) + path2 := appendOpArg(path, opField, i) + if fld == obj { + return path2 // found field var + } + if r := find(obj, fld.Type(), append(path2, opType), seen); r != nil { + return r + } + } + return nil + case *types.Tuple: + for i := 0; i < T.Len(); i++ { + v := T.At(i) + path2 := appendOpArg(path, opAt, i) + if v == obj { + return path2 // found param/result var + } + if r := find(obj, v.Type(), append(path2, opType), seen); r != nil { + return r + } + } + return nil + case *types.Interface: + for i := 0; i < T.NumMethods(); i++ { + m := T.Method(i) + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return path2 // found interface method + } + if r := find(obj, m.Type(), append(path2, opType), seen); r != nil { + return r + } + } + return nil + case *typeparams.TypeParam: + name := T.Obj() + if name == obj { + return append(path, opObj) + } + if seen[name] { + return nil + } + if seen == nil { + seen = make(map[*types.TypeName]bool) + } + seen[name] = true + if r := find(obj, T.Constraint(), append(path, opConstraint), seen); r != nil { + return r + } + return nil + } + panic(T) +} + +func findTypeParam(obj types.Object, list *typeparams.TypeParamList, path []byte, seen map[*types.TypeName]bool) []byte { + for i := 0; i < list.Len(); i++ { + tparam := list.At(i) + path2 := appendOpArg(path, opTypeParam, i) + if r := find(obj, tparam, path2, seen); r != nil { + return r + } + } + return nil +} + +// Object returns the object denoted by path p within the package pkg. +func Object(pkg *types.Package, p Path) (types.Object, error) { + return object(pkg, string(p), false) +} + +// Note: the skipMethodSorting parameter must match the value of +// Encoder.skipMethodSorting used during encoding. +func object(pkg *types.Package, pathstr string, skipMethodSorting bool) (types.Object, error) { + if pathstr == "" { + return nil, fmt.Errorf("empty path") + } + + var pkgobj, suffix string + if dot := strings.IndexByte(pathstr, opType); dot < 0 { + pkgobj = pathstr + } else { + pkgobj = pathstr[:dot] + suffix = pathstr[dot:] // suffix starts with "." + } + + obj := pkg.Scope().Lookup(pkgobj) + if obj == nil { + return nil, fmt.Errorf("package %s does not contain %q", pkg.Path(), pkgobj) + } + + // abstraction of *types.{Pointer,Slice,Array,Chan,Map} + type hasElem interface { + Elem() types.Type + } + // abstraction of *types.{Named,Signature} + type hasTypeParams interface { + TypeParams() *typeparams.TypeParamList + } + // abstraction of *types.{Named,TypeParam} + type hasObj interface { + Obj() *types.TypeName + } + + // The loop state is the pair (t, obj), + // exactly one of which is non-nil, initially obj. + // All suffixes start with '.' (the only object->type operation), + // followed by optional type->type operations, + // then a type->object operation. + // The cycle then repeats. + var t types.Type + for suffix != "" { + code := suffix[0] + suffix = suffix[1:] + + // Codes [AFM] have an integer operand. + var index int + switch code { + case opAt, opField, opMethod, opTypeParam: + rest := strings.TrimLeft(suffix, "0123456789") + numerals := suffix[:len(suffix)-len(rest)] + suffix = rest + i, err := strconv.Atoi(numerals) + if err != nil { + return nil, fmt.Errorf("invalid path: bad numeric operand %q for code %q", numerals, code) + } + index = int(i) + case opObj: + // no operand + default: + // The suffix must end with a type->object operation. + if suffix == "" { + return nil, fmt.Errorf("invalid path: ends with %q, want [AFMO]", code) + } + } + + if code == opType { + if t != nil { + return nil, fmt.Errorf("invalid path: unexpected %q in type context", opType) + } + t = obj.Type() + obj = nil + continue + } + + if t == nil { + return nil, fmt.Errorf("invalid path: code %q in object context", code) + } + + // Inv: t != nil, obj == nil + + switch code { + case opElem: + hasElem, ok := t.(hasElem) // Pointer, Slice, Array, Chan, Map + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want pointer, slice, array, chan or map)", code, t, t) + } + t = hasElem.Elem() + + case opKey: + mapType, ok := t.(*types.Map) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want map)", code, t, t) + } + t = mapType.Key() + + case opParams: + sig, ok := t.(*types.Signature) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t) + } + t = sig.Params() + + case opResults: + sig, ok := t.(*types.Signature) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t) + } + t = sig.Results() + + case opUnderlying: + named, ok := t.(*types.Named) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named)", code, t, t) + } + t = named.Underlying() + + case opTypeParam: + hasTypeParams, ok := t.(hasTypeParams) // Named, Signature + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or signature)", code, t, t) + } + tparams := hasTypeParams.TypeParams() + if n := tparams.Len(); index >= n { + return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n) + } + t = tparams.At(index) + + case opConstraint: + tparam, ok := t.(*typeparams.TypeParam) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want type parameter)", code, t, t) + } + t = tparam.Constraint() + + case opAt: + tuple, ok := t.(*types.Tuple) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want tuple)", code, t, t) + } + if n := tuple.Len(); index >= n { + return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n) + } + obj = tuple.At(index) + t = nil + + case opField: + structType, ok := t.(*types.Struct) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want struct)", code, t, t) + } + if n := structType.NumFields(); index >= n { + return nil, fmt.Errorf("field index %d out of range [0-%d)", index, n) + } + obj = structType.Field(index) + t = nil + + case opMethod: + switch t := t.(type) { + case *types.Interface: + if index >= t.NumMethods() { + return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods()) + } + obj = t.Method(index) // Id-ordered + + case *types.Named: + if index >= t.NumMethods() { + return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods()) + } + if skipMethodSorting { + obj = t.Method(index) + } else { + methods := namedMethods(t) // (unmemoized) + obj = methods[index] // Id-ordered + } + + default: + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want interface or named)", code, t, t) + } + t = nil + + case opObj: + hasObj, ok := t.(hasObj) + if !ok { + return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or type param)", code, t, t) + } + obj = hasObj.Obj() + t = nil + + default: + return nil, fmt.Errorf("invalid path: unknown code %q", code) + } + } + + if obj.Pkg() != pkg { + return nil, fmt.Errorf("path denotes %s, which belongs to a different package", obj) + } + + return obj, nil // success +} + +// namedMethods returns the methods of a Named type in ascending Id order. +func namedMethods(named *types.Named) []*types.Func { + methods := make([]*types.Func, named.NumMethods()) + for i := range methods { + methods[i] = named.Method(i) + } + sort.Slice(methods, func(i, j int) bool { + return methods[i].Id() < methods[j].Id() + }) + return methods +} + +// namedMethods is a memoization of the namedMethods function. Callers must not modify the result. +func (enc *Encoder) namedMethods(named *types.Named) []*types.Func { + m := enc.namedMethodsMemo + if m == nil { + m = make(map[*types.Named][]*types.Func) + enc.namedMethodsMemo = m + } + methods, ok := m[named] + if !ok { + methods = namedMethods(named) // allocates and sorts + m[named] = methods + } + return methods +} + +// scopeObjects is a memoization of scope objects. +// Callers must not modify the result. +func (enc *Encoder) scopeObjects(scope *types.Scope) []types.Object { + m := enc.scopeMemo + if m == nil { + m = make(map[*types.Scope][]types.Object) + enc.scopeMemo = m + } + objs, ok := m[scope] + if !ok { + names := scope.Names() // allocates and sorts + objs = make([]types.Object, len(names)) + for i, name := range names { + objs[i] = scope.Lookup(name) + } + m[scope] = objs + } + return objs +} diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go new file mode 100644 index 0000000..581b26c --- /dev/null +++ b/vendor/golang.org/x/tools/internal/event/tag/tag.go @@ -0,0 +1,59 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag provides the labels used for telemetry throughout gopls. +package tag + +import ( + "golang.org/x/tools/internal/event/keys" +) + +var ( + // create the label keys we use + Method = keys.NewString("method", "") + StatusCode = keys.NewString("status.code", "") + StatusMessage = keys.NewString("status.message", "") + RPCID = keys.NewString("id", "") + RPCDirection = keys.NewString("direction", "") + File = keys.NewString("file", "") + Directory = keys.New("directory", "") + URI = keys.New("URI", "") + Package = keys.NewString("package", "") // sorted comma-separated list of Package IDs + PackagePath = keys.NewString("package_path", "") + Query = keys.New("query", "") + Snapshot = keys.NewUInt64("snapshot", "") + Operation = keys.NewString("operation", "") + + Position = keys.New("position", "") + Category = keys.NewString("category", "") + PackageCount = keys.NewInt("packages", "") + Files = keys.New("files", "") + Port = keys.NewInt("port", "") + Type = keys.New("type", "") + HoverKind = keys.NewString("hoverkind", "") + + NewServer = keys.NewString("new_server", "A new server was added") + EndServer = keys.NewString("end_server", "A server was shut down") + + ServerID = keys.NewString("server", "The server ID an event is related to") + Logfile = keys.NewString("logfile", "") + DebugAddress = keys.NewString("debug_address", "") + GoplsPath = keys.NewString("gopls_path", "") + ClientID = keys.NewString("client_id", "") + + Level = keys.NewInt("level", "The logging level") +) + +var ( + // create the stats we measure + Started = keys.NewInt64("started", "Count of started RPCs.") + ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.") //, unit.Bytes) + SentBytes = keys.NewInt64("sent_bytes", "Bytes sent.") //, unit.Bytes) + Latency = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds) +) + +const ( + Inbound = "in" + Outbound = "out" +) diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go index 798fe59..c40c7e9 100644 --- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go +++ b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package fastwalk provides a faster version of filepath.Walk for file system +// Package fastwalk provides a faster version of [filepath.Walk] for file system // scanning tools. package fastwalk @@ -23,31 +23,31 @@ var ErrTraverseLink = errors.New("fastwalk: traverse symlink, assuming target is // Child directories will still be traversed. var ErrSkipFiles = errors.New("fastwalk: skip remaining files in directory") -// Walk is a faster implementation of filepath.Walk. +// Walk is a faster implementation of [filepath.Walk]. // -// filepath.Walk's design necessarily calls os.Lstat on each file, +// [filepath.Walk]'s design necessarily calls [os.Lstat] on each file, // even if the caller needs less info. // Many tools need only the type of each file. // On some platforms, this information is provided directly by the readdir // system call, avoiding the need to stat each file individually. // fastwalk_unix.go contains a fork of the syscall routines. // -// See golang.org/issue/16399 +// See golang.org/issue/16399. // // Walk walks the file tree rooted at root, calling walkFn for // each file or directory in the tree, including root. // -// If fastWalk returns filepath.SkipDir, the directory is skipped. +// If Walk returns [filepath.SkipDir], the directory is skipped. // -// Unlike filepath.Walk: +// Unlike [filepath.Walk]: // - file stat calls must be done by the user. // The only provided metadata is the file type, which does not include // any permission bits. // - multiple goroutines stat the filesystem concurrently. The provided // walkFn must be safe for concurrent use. -// - fastWalk can follow symlinks if walkFn returns the TraverseLink +// - Walk can follow symlinks if walkFn returns the TraverseLink // sentinel error. It is the walkFn's responsibility to prevent -// fastWalk from going into symlink cycles. +// Walk from going into symlink cycles. func Walk(root string, walkFn func(path string, typ os.FileMode) error) error { // TODO(bradfitz): make numWorkers configurable? We used a // minimum of 4 to give the kernel more info about multiple diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go b/vendor/golang.org/x/tools/internal/gcimporter/bexport.go deleted file mode 100644 index 30582ed..0000000 --- a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go +++ /dev/null @@ -1,852 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Binary package export. -// This file was derived from $GOROOT/src/cmd/compile/internal/gc/bexport.go; -// see that file for specification of the format. - -package gcimporter - -import ( - "bytes" - "encoding/binary" - "fmt" - "go/constant" - "go/token" - "go/types" - "math" - "math/big" - "sort" - "strings" -) - -// If debugFormat is set, each integer and string value is preceded by a marker -// and position information in the encoding. This mechanism permits an importer -// to recognize immediately when it is out of sync. The importer recognizes this -// mode automatically (i.e., it can import export data produced with debugging -// support even if debugFormat is not set at the time of import). This mode will -// lead to massively larger export data (by a factor of 2 to 3) and should only -// be enabled during development and debugging. -// -// NOTE: This flag is the first flag to enable if importing dies because of -// (suspected) format errors, and whenever a change is made to the format. -const debugFormat = false // default: false - -// Current export format version. Increase with each format change. -// -// Note: The latest binary (non-indexed) export format is at version 6. -// This exporter is still at level 4, but it doesn't matter since -// the binary importer can handle older versions just fine. -// -// 6: package height (CL 105038) -- NOT IMPLEMENTED HERE -// 5: improved position encoding efficiency (issue 20080, CL 41619) -- NOT IMPLEMENTED HERE -// 4: type name objects support type aliases, uses aliasTag -// 3: Go1.8 encoding (same as version 2, aliasTag defined but never used) -// 2: removed unused bool in ODCL export (compiler only) -// 1: header format change (more regular), export package for _ struct fields -// 0: Go1.7 encoding -const exportVersion = 4 - -// trackAllTypes enables cycle tracking for all types, not just named -// types. The existing compiler invariants assume that unnamed types -// that are not completely set up are not used, or else there are spurious -// errors. -// If disabled, only named types are tracked, possibly leading to slightly -// less efficient encoding in rare cases. It also prevents the export of -// some corner-case type declarations (but those are not handled correctly -// with with the textual export format either). -// TODO(gri) enable and remove once issues caused by it are fixed -const trackAllTypes = false - -type exporter struct { - fset *token.FileSet - out bytes.Buffer - - // object -> index maps, indexed in order of serialization - strIndex map[string]int - pkgIndex map[*types.Package]int - typIndex map[types.Type]int - - // position encoding - posInfoFormat bool - prevFile string - prevLine int - - // debugging support - written int // bytes written - indent int // for trace -} - -// internalError represents an error generated inside this package. -type internalError string - -func (e internalError) Error() string { return "gcimporter: " + string(e) } - -func internalErrorf(format string, args ...interface{}) error { - return internalError(fmt.Sprintf(format, args...)) -} - -// BExportData returns binary export data for pkg. -// If no file set is provided, position info will be missing. -func BExportData(fset *token.FileSet, pkg *types.Package) (b []byte, err error) { - if !debug { - defer func() { - if e := recover(); e != nil { - if ierr, ok := e.(internalError); ok { - err = ierr - return - } - // Not an internal error; panic again. - panic(e) - } - }() - } - - p := exporter{ - fset: fset, - strIndex: map[string]int{"": 0}, // empty string is mapped to 0 - pkgIndex: make(map[*types.Package]int), - typIndex: make(map[types.Type]int), - posInfoFormat: true, // TODO(gri) might become a flag, eventually - } - - // write version info - // The version string must start with "version %d" where %d is the version - // number. Additional debugging information may follow after a blank; that - // text is ignored by the importer. - p.rawStringln(fmt.Sprintf("version %d", exportVersion)) - var debug string - if debugFormat { - debug = "debug" - } - p.rawStringln(debug) // cannot use p.bool since it's affected by debugFormat; also want to see this clearly - p.bool(trackAllTypes) - p.bool(p.posInfoFormat) - - // --- generic export data --- - - // populate type map with predeclared "known" types - for index, typ := range predeclared() { - p.typIndex[typ] = index - } - if len(p.typIndex) != len(predeclared()) { - return nil, internalError("duplicate entries in type map?") - } - - // write package data - p.pkg(pkg, true) - if trace { - p.tracef("\n") - } - - // write objects - objcount := 0 - scope := pkg.Scope() - for _, name := range scope.Names() { - if !token.IsExported(name) { - continue - } - if trace { - p.tracef("\n") - } - p.obj(scope.Lookup(name)) - objcount++ - } - - // indicate end of list - if trace { - p.tracef("\n") - } - p.tag(endTag) - - // for self-verification only (redundant) - p.int(objcount) - - if trace { - p.tracef("\n") - } - - // --- end of export data --- - - return p.out.Bytes(), nil -} - -func (p *exporter) pkg(pkg *types.Package, emptypath bool) { - if pkg == nil { - panic(internalError("unexpected nil pkg")) - } - - // if we saw the package before, write its index (>= 0) - if i, ok := p.pkgIndex[pkg]; ok { - p.index('P', i) - return - } - - // otherwise, remember the package, write the package tag (< 0) and package data - if trace { - p.tracef("P%d = { ", len(p.pkgIndex)) - defer p.tracef("} ") - } - p.pkgIndex[pkg] = len(p.pkgIndex) - - p.tag(packageTag) - p.string(pkg.Name()) - if emptypath { - p.string("") - } else { - p.string(pkg.Path()) - } -} - -func (p *exporter) obj(obj types.Object) { - switch obj := obj.(type) { - case *types.Const: - p.tag(constTag) - p.pos(obj) - p.qualifiedName(obj) - p.typ(obj.Type()) - p.value(obj.Val()) - - case *types.TypeName: - if obj.IsAlias() { - p.tag(aliasTag) - p.pos(obj) - p.qualifiedName(obj) - } else { - p.tag(typeTag) - } - p.typ(obj.Type()) - - case *types.Var: - p.tag(varTag) - p.pos(obj) - p.qualifiedName(obj) - p.typ(obj.Type()) - - case *types.Func: - p.tag(funcTag) - p.pos(obj) - p.qualifiedName(obj) - sig := obj.Type().(*types.Signature) - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) - - default: - panic(internalErrorf("unexpected object %v (%T)", obj, obj)) - } -} - -func (p *exporter) pos(obj types.Object) { - if !p.posInfoFormat { - return - } - - file, line := p.fileLine(obj) - if file == p.prevFile { - // common case: write line delta - // delta == 0 means different file or no line change - delta := line - p.prevLine - p.int(delta) - if delta == 0 { - p.int(-1) // -1 means no file change - } - } else { - // different file - p.int(0) - // Encode filename as length of common prefix with previous - // filename, followed by (possibly empty) suffix. Filenames - // frequently share path prefixes, so this can save a lot - // of space and make export data size less dependent on file - // path length. The suffix is unlikely to be empty because - // file names tend to end in ".go". - n := commonPrefixLen(p.prevFile, file) - p.int(n) // n >= 0 - p.string(file[n:]) // write suffix only - p.prevFile = file - p.int(line) - } - p.prevLine = line -} - -func (p *exporter) fileLine(obj types.Object) (file string, line int) { - if p.fset != nil { - pos := p.fset.Position(obj.Pos()) - file = pos.Filename - line = pos.Line - } - return -} - -func commonPrefixLen(a, b string) int { - if len(a) > len(b) { - a, b = b, a - } - // len(a) <= len(b) - i := 0 - for i < len(a) && a[i] == b[i] { - i++ - } - return i -} - -func (p *exporter) qualifiedName(obj types.Object) { - p.string(obj.Name()) - p.pkg(obj.Pkg(), false) -} - -func (p *exporter) typ(t types.Type) { - if t == nil { - panic(internalError("nil type")) - } - - // Possible optimization: Anonymous pointer types *T where - // T is a named type are common. We could canonicalize all - // such types *T to a single type PT = *T. This would lead - // to at most one *T entry in typIndex, and all future *T's - // would be encoded as the respective index directly. Would - // save 1 byte (pointerTag) per *T and reduce the typIndex - // size (at the cost of a canonicalization map). We can do - // this later, without encoding format change. - - // if we saw the type before, write its index (>= 0) - if i, ok := p.typIndex[t]; ok { - p.index('T', i) - return - } - - // otherwise, remember the type, write the type tag (< 0) and type data - if trackAllTypes { - if trace { - p.tracef("T%d = {>\n", len(p.typIndex)) - defer p.tracef("<\n} ") - } - p.typIndex[t] = len(p.typIndex) - } - - switch t := t.(type) { - case *types.Named: - if !trackAllTypes { - // if we don't track all types, track named types now - p.typIndex[t] = len(p.typIndex) - } - - p.tag(namedTag) - p.pos(t.Obj()) - p.qualifiedName(t.Obj()) - p.typ(t.Underlying()) - if !types.IsInterface(t) { - p.assocMethods(t) - } - - case *types.Array: - p.tag(arrayTag) - p.int64(t.Len()) - p.typ(t.Elem()) - - case *types.Slice: - p.tag(sliceTag) - p.typ(t.Elem()) - - case *dddSlice: - p.tag(dddTag) - p.typ(t.elem) - - case *types.Struct: - p.tag(structTag) - p.fieldList(t) - - case *types.Pointer: - p.tag(pointerTag) - p.typ(t.Elem()) - - case *types.Signature: - p.tag(signatureTag) - p.paramList(t.Params(), t.Variadic()) - p.paramList(t.Results(), false) - - case *types.Interface: - p.tag(interfaceTag) - p.iface(t) - - case *types.Map: - p.tag(mapTag) - p.typ(t.Key()) - p.typ(t.Elem()) - - case *types.Chan: - p.tag(chanTag) - p.int(int(3 - t.Dir())) // hack - p.typ(t.Elem()) - - default: - panic(internalErrorf("unexpected type %T: %s", t, t)) - } -} - -func (p *exporter) assocMethods(named *types.Named) { - // Sort methods (for determinism). - var methods []*types.Func - for i := 0; i < named.NumMethods(); i++ { - methods = append(methods, named.Method(i)) - } - sort.Sort(methodsByName(methods)) - - p.int(len(methods)) - - if trace && methods != nil { - p.tracef("associated methods {>\n") - } - - for i, m := range methods { - if trace && i > 0 { - p.tracef("\n") - } - - p.pos(m) - name := m.Name() - p.string(name) - if !exported(name) { - p.pkg(m.Pkg(), false) - } - - sig := m.Type().(*types.Signature) - p.paramList(types.NewTuple(sig.Recv()), false) - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) - p.int(0) // dummy value for go:nointerface pragma - ignored by importer - } - - if trace && methods != nil { - p.tracef("<\n} ") - } -} - -type methodsByName []*types.Func - -func (x methodsByName) Len() int { return len(x) } -func (x methodsByName) Swap(i, j int) { x[i], x[j] = x[j], x[i] } -func (x methodsByName) Less(i, j int) bool { return x[i].Name() < x[j].Name() } - -func (p *exporter) fieldList(t *types.Struct) { - if trace && t.NumFields() > 0 { - p.tracef("fields {>\n") - defer p.tracef("<\n} ") - } - - p.int(t.NumFields()) - for i := 0; i < t.NumFields(); i++ { - if trace && i > 0 { - p.tracef("\n") - } - p.field(t.Field(i)) - p.string(t.Tag(i)) - } -} - -func (p *exporter) field(f *types.Var) { - if !f.IsField() { - panic(internalError("field expected")) - } - - p.pos(f) - p.fieldName(f) - p.typ(f.Type()) -} - -func (p *exporter) iface(t *types.Interface) { - // TODO(gri): enable importer to load embedded interfaces, - // then emit Embeddeds and ExplicitMethods separately here. - p.int(0) - - n := t.NumMethods() - if trace && n > 0 { - p.tracef("methods {>\n") - defer p.tracef("<\n} ") - } - p.int(n) - for i := 0; i < n; i++ { - if trace && i > 0 { - p.tracef("\n") - } - p.method(t.Method(i)) - } -} - -func (p *exporter) method(m *types.Func) { - sig := m.Type().(*types.Signature) - if sig.Recv() == nil { - panic(internalError("method expected")) - } - - p.pos(m) - p.string(m.Name()) - if m.Name() != "_" && !token.IsExported(m.Name()) { - p.pkg(m.Pkg(), false) - } - - // interface method; no need to encode receiver. - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) -} - -func (p *exporter) fieldName(f *types.Var) { - name := f.Name() - - if f.Anonymous() { - // anonymous field - we distinguish between 3 cases: - // 1) field name matches base type name and is exported - // 2) field name matches base type name and is not exported - // 3) field name doesn't match base type name (alias name) - bname := basetypeName(f.Type()) - if name == bname { - if token.IsExported(name) { - name = "" // 1) we don't need to know the field name or package - } else { - name = "?" // 2) use unexported name "?" to force package export - } - } else { - // 3) indicate alias and export name as is - // (this requires an extra "@" but this is a rare case) - p.string("@") - } - } - - p.string(name) - if name != "" && !token.IsExported(name) { - p.pkg(f.Pkg(), false) - } -} - -func basetypeName(typ types.Type) string { - switch typ := deref(typ).(type) { - case *types.Basic: - return typ.Name() - case *types.Named: - return typ.Obj().Name() - default: - return "" // unnamed type - } -} - -func (p *exporter) paramList(params *types.Tuple, variadic bool) { - // use negative length to indicate unnamed parameters - // (look at the first parameter only since either all - // names are present or all are absent) - n := params.Len() - if n > 0 && params.At(0).Name() == "" { - n = -n - } - p.int(n) - for i := 0; i < params.Len(); i++ { - q := params.At(i) - t := q.Type() - if variadic && i == params.Len()-1 { - t = &dddSlice{t.(*types.Slice).Elem()} - } - p.typ(t) - if n > 0 { - name := q.Name() - p.string(name) - if name != "_" { - p.pkg(q.Pkg(), false) - } - } - p.string("") // no compiler-specific info - } -} - -func (p *exporter) value(x constant.Value) { - if trace { - p.tracef("= ") - } - - switch x.Kind() { - case constant.Bool: - tag := falseTag - if constant.BoolVal(x) { - tag = trueTag - } - p.tag(tag) - - case constant.Int: - if v, exact := constant.Int64Val(x); exact { - // common case: x fits into an int64 - use compact encoding - p.tag(int64Tag) - p.int64(v) - return - } - // uncommon case: large x - use float encoding - // (powers of 2 will be encoded efficiently with exponent) - p.tag(floatTag) - p.float(constant.ToFloat(x)) - - case constant.Float: - p.tag(floatTag) - p.float(x) - - case constant.Complex: - p.tag(complexTag) - p.float(constant.Real(x)) - p.float(constant.Imag(x)) - - case constant.String: - p.tag(stringTag) - p.string(constant.StringVal(x)) - - case constant.Unknown: - // package contains type errors - p.tag(unknownTag) - - default: - panic(internalErrorf("unexpected value %v (%T)", x, x)) - } -} - -func (p *exporter) float(x constant.Value) { - if x.Kind() != constant.Float { - panic(internalErrorf("unexpected constant %v, want float", x)) - } - // extract sign (there is no -0) - sign := constant.Sign(x) - if sign == 0 { - // x == 0 - p.int(0) - return - } - // x != 0 - - var f big.Float - if v, exact := constant.Float64Val(x); exact { - // float64 - f.SetFloat64(v) - } else if num, denom := constant.Num(x), constant.Denom(x); num.Kind() == constant.Int { - // TODO(gri): add big.Rat accessor to constant.Value. - r := valueToRat(num) - f.SetRat(r.Quo(r, valueToRat(denom))) - } else { - // Value too large to represent as a fraction => inaccessible. - // TODO(gri): add big.Float accessor to constant.Value. - f.SetFloat64(math.MaxFloat64) // FIXME - } - - // extract exponent such that 0.5 <= m < 1.0 - var m big.Float - exp := f.MantExp(&m) - - // extract mantissa as *big.Int - // - set exponent large enough so mant satisfies mant.IsInt() - // - get *big.Int from mant - m.SetMantExp(&m, int(m.MinPrec())) - mant, acc := m.Int(nil) - if acc != big.Exact { - panic(internalError("internal error")) - } - - p.int(sign) - p.int(exp) - p.string(string(mant.Bytes())) -} - -func valueToRat(x constant.Value) *big.Rat { - // Convert little-endian to big-endian. - // I can't believe this is necessary. - bytes := constant.Bytes(x) - for i := 0; i < len(bytes)/2; i++ { - bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i] - } - return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes)) -} - -func (p *exporter) bool(b bool) bool { - if trace { - p.tracef("[") - defer p.tracef("= %v] ", b) - } - - x := 0 - if b { - x = 1 - } - p.int(x) - return b -} - -// ---------------------------------------------------------------------------- -// Low-level encoders - -func (p *exporter) index(marker byte, index int) { - if index < 0 { - panic(internalError("invalid index < 0")) - } - if debugFormat { - p.marker('t') - } - if trace { - p.tracef("%c%d ", marker, index) - } - p.rawInt64(int64(index)) -} - -func (p *exporter) tag(tag int) { - if tag >= 0 { - panic(internalError("invalid tag >= 0")) - } - if debugFormat { - p.marker('t') - } - if trace { - p.tracef("%s ", tagString[-tag]) - } - p.rawInt64(int64(tag)) -} - -func (p *exporter) int(x int) { - p.int64(int64(x)) -} - -func (p *exporter) int64(x int64) { - if debugFormat { - p.marker('i') - } - if trace { - p.tracef("%d ", x) - } - p.rawInt64(x) -} - -func (p *exporter) string(s string) { - if debugFormat { - p.marker('s') - } - if trace { - p.tracef("%q ", s) - } - // if we saw the string before, write its index (>= 0) - // (the empty string is mapped to 0) - if i, ok := p.strIndex[s]; ok { - p.rawInt64(int64(i)) - return - } - // otherwise, remember string and write its negative length and bytes - p.strIndex[s] = len(p.strIndex) - p.rawInt64(-int64(len(s))) - for i := 0; i < len(s); i++ { - p.rawByte(s[i]) - } -} - -// marker emits a marker byte and position information which makes -// it easy for a reader to detect if it is "out of sync". Used for -// debugFormat format only. -func (p *exporter) marker(m byte) { - p.rawByte(m) - // Enable this for help tracking down the location - // of an incorrect marker when running in debugFormat. - if false && trace { - p.tracef("#%d ", p.written) - } - p.rawInt64(int64(p.written)) -} - -// rawInt64 should only be used by low-level encoders. -func (p *exporter) rawInt64(x int64) { - var tmp [binary.MaxVarintLen64]byte - n := binary.PutVarint(tmp[:], x) - for i := 0; i < n; i++ { - p.rawByte(tmp[i]) - } -} - -// rawStringln should only be used to emit the initial version string. -func (p *exporter) rawStringln(s string) { - for i := 0; i < len(s); i++ { - p.rawByte(s[i]) - } - p.rawByte('\n') -} - -// rawByte is the bottleneck interface to write to p.out. -// rawByte escapes b as follows (any encoding does that -// hides '$'): -// -// '$' => '|' 'S' -// '|' => '|' '|' -// -// Necessary so other tools can find the end of the -// export data by searching for "$$". -// rawByte should only be used by low-level encoders. -func (p *exporter) rawByte(b byte) { - switch b { - case '$': - // write '$' as '|' 'S' - b = 'S' - fallthrough - case '|': - // write '|' as '|' '|' - p.out.WriteByte('|') - p.written++ - } - p.out.WriteByte(b) - p.written++ -} - -// tracef is like fmt.Printf but it rewrites the format string -// to take care of indentation. -func (p *exporter) tracef(format string, args ...interface{}) { - if strings.ContainsAny(format, "<>\n") { - var buf bytes.Buffer - for i := 0; i < len(format); i++ { - // no need to deal with runes - ch := format[i] - switch ch { - case '>': - p.indent++ - continue - case '<': - p.indent-- - continue - } - buf.WriteByte(ch) - if ch == '\n' { - for j := p.indent; j > 0; j-- { - buf.WriteString(". ") - } - } - } - format = buf.String() - } - fmt.Printf(format, args...) -} - -// Debugging support. -// (tagString is only used when tracing is enabled) -var tagString = [...]string{ - // Packages - -packageTag: "package", - - // Types - -namedTag: "named type", - -arrayTag: "array", - -sliceTag: "slice", - -dddTag: "ddd", - -structTag: "struct", - -pointerTag: "pointer", - -signatureTag: "signature", - -interfaceTag: "interface", - -mapTag: "map", - -chanTag: "chan", - - // Values - -falseTag: "false", - -trueTag: "true", - -int64Tag: "int64", - -floatTag: "float", - -fractionTag: "fraction", - -complexTag: "complex", - -stringTag: "string", - -unknownTag: "unknown", - - // Type aliases - -aliasTag: "alias", -} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go index b85de01..d98b0db 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go @@ -2,340 +2,24 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// This file is a copy of $GOROOT/src/go/internal/gcimporter/bimport.go. +// This file contains the remaining vestiges of +// $GOROOT/src/go/internal/gcimporter/bimport.go. package gcimporter import ( - "encoding/binary" "fmt" - "go/constant" "go/token" "go/types" - "sort" - "strconv" - "strings" "sync" - "unicode" - "unicode/utf8" ) -type importer struct { - imports map[string]*types.Package - data []byte - importpath string - buf []byte // for reading strings - version int // export format version - - // object lists - strList []string // in order of appearance - pathList []string // in order of appearance - pkgList []*types.Package // in order of appearance - typList []types.Type // in order of appearance - interfaceList []*types.Interface // for delayed completion only - trackAllTypes bool - - // position encoding - posInfoFormat bool - prevFile string - prevLine int - fake fakeFileSet - - // debugging support - debugFormat bool - read int // bytes read -} - -// BImportData imports a package from the serialized package data -// and returns the number of bytes consumed and a reference to the package. -// If the export data version is not recognized or the format is otherwise -// compromised, an error is returned. -func BImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { - // catch panics and return them as errors - const currentVersion = 6 - version := -1 // unknown version - defer func() { - if e := recover(); e != nil { - // Return a (possibly nil or incomplete) package unchanged (see #16088). - if version > currentVersion { - err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e) - } else { - err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e) - } - } - }() - - p := importer{ - imports: imports, - data: data, - importpath: path, - version: version, - strList: []string{""}, // empty string is mapped to 0 - pathList: []string{""}, // empty string is mapped to 0 - fake: fakeFileSet{ - fset: fset, - files: make(map[string]*fileInfo), - }, - } - defer p.fake.setLines() // set lines for files in fset - - // read version info - var versionstr string - if b := p.rawByte(); b == 'c' || b == 'd' { - // Go1.7 encoding; first byte encodes low-level - // encoding format (compact vs debug). - // For backward-compatibility only (avoid problems with - // old installed packages). Newly compiled packages use - // the extensible format string. - // TODO(gri) Remove this support eventually; after Go1.8. - if b == 'd' { - p.debugFormat = true - } - p.trackAllTypes = p.rawByte() == 'a' - p.posInfoFormat = p.int() != 0 - versionstr = p.string() - if versionstr == "v1" { - version = 0 - } - } else { - // Go1.8 extensible encoding - // read version string and extract version number (ignore anything after the version number) - versionstr = p.rawStringln(b) - if s := strings.SplitN(versionstr, " ", 3); len(s) >= 2 && s[0] == "version" { - if v, err := strconv.Atoi(s[1]); err == nil && v > 0 { - version = v - } - } - } - p.version = version - - // read version specific flags - extend as necessary - switch p.version { - // case currentVersion: - // ... - // fallthrough - case currentVersion, 5, 4, 3, 2, 1: - p.debugFormat = p.rawStringln(p.rawByte()) == "debug" - p.trackAllTypes = p.int() != 0 - p.posInfoFormat = p.int() != 0 - case 0: - // Go1.7 encoding format - nothing to do here - default: - errorf("unknown bexport format version %d (%q)", p.version, versionstr) - } - - // --- generic export data --- - - // populate typList with predeclared "known" types - p.typList = append(p.typList, predeclared()...) - - // read package data - pkg = p.pkg() - - // read objects of phase 1 only (see cmd/compile/internal/gc/bexport.go) - objcount := 0 - for { - tag := p.tagOrIndex() - if tag == endTag { - break - } - p.obj(tag) - objcount++ - } - - // self-verification - if count := p.int(); count != objcount { - errorf("got %d objects; want %d", objcount, count) - } - - // ignore compiler-specific import data - - // complete interfaces - // TODO(gri) re-investigate if we still need to do this in a delayed fashion - for _, typ := range p.interfaceList { - typ.Complete() - } - - // record all referenced packages as imports - list := append(([]*types.Package)(nil), p.pkgList[1:]...) - sort.Sort(byPath(list)) - pkg.SetImports(list) - - // package was imported completely and without errors - pkg.MarkComplete() - - return p.read, pkg, nil -} - func errorf(format string, args ...interface{}) { panic(fmt.Sprintf(format, args...)) } -func (p *importer) pkg() *types.Package { - // if the package was seen before, i is its index (>= 0) - i := p.tagOrIndex() - if i >= 0 { - return p.pkgList[i] - } - - // otherwise, i is the package tag (< 0) - if i != packageTag { - errorf("unexpected package tag %d version %d", i, p.version) - } - - // read package data - name := p.string() - var path string - if p.version >= 5 { - path = p.path() - } else { - path = p.string() - } - if p.version >= 6 { - p.int() // package height; unused by go/types - } - - // we should never see an empty package name - if name == "" { - errorf("empty package name in import") - } - - // an empty path denotes the package we are currently importing; - // it must be the first package we see - if (path == "") != (len(p.pkgList) == 0) { - errorf("package path %q for pkg index %d", path, len(p.pkgList)) - } - - // if the package was imported before, use that one; otherwise create a new one - if path == "" { - path = p.importpath - } - pkg := p.imports[path] - if pkg == nil { - pkg = types.NewPackage(path, name) - p.imports[path] = pkg - } else if pkg.Name() != name { - errorf("conflicting names %s and %s for package %q", pkg.Name(), name, path) - } - p.pkgList = append(p.pkgList, pkg) - - return pkg -} - -// objTag returns the tag value for each object kind. -func objTag(obj types.Object) int { - switch obj.(type) { - case *types.Const: - return constTag - case *types.TypeName: - return typeTag - case *types.Var: - return varTag - case *types.Func: - return funcTag - default: - errorf("unexpected object: %v (%T)", obj, obj) // panics - panic("unreachable") - } -} - -func sameObj(a, b types.Object) bool { - // Because unnamed types are not canonicalized, we cannot simply compare types for - // (pointer) identity. - // Ideally we'd check equality of constant values as well, but this is good enough. - return objTag(a) == objTag(b) && types.Identical(a.Type(), b.Type()) -} - -func (p *importer) declare(obj types.Object) { - pkg := obj.Pkg() - if alt := pkg.Scope().Insert(obj); alt != nil { - // This can only trigger if we import a (non-type) object a second time. - // Excluding type aliases, this cannot happen because 1) we only import a package - // once; and b) we ignore compiler-specific export data which may contain - // functions whose inlined function bodies refer to other functions that - // were already imported. - // However, type aliases require reexporting the original type, so we need - // to allow it (see also the comment in cmd/compile/internal/gc/bimport.go, - // method importer.obj, switch case importing functions). - // TODO(gri) review/update this comment once the gc compiler handles type aliases. - if !sameObj(obj, alt) { - errorf("inconsistent import:\n\t%v\npreviously imported as:\n\t%v\n", obj, alt) - } - } -} - -func (p *importer) obj(tag int) { - switch tag { - case constTag: - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - val := p.value() - p.declare(types.NewConst(pos, pkg, name, typ, val)) - - case aliasTag: - // TODO(gri) verify type alias hookup is correct - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - p.declare(types.NewTypeName(pos, pkg, name, typ)) - - case typeTag: - p.typ(nil, nil) - - case varTag: - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - p.declare(types.NewVar(pos, pkg, name, typ)) - - case funcTag: - pos := p.pos() - pkg, name := p.qualifiedName() - params, isddd := p.paramList() - result, _ := p.paramList() - sig := types.NewSignature(nil, params, result, isddd) - p.declare(types.NewFunc(pos, pkg, name, sig)) - - default: - errorf("unexpected object tag %d", tag) - } -} - const deltaNewFile = -64 // see cmd/compile/internal/gc/bexport.go -func (p *importer) pos() token.Pos { - if !p.posInfoFormat { - return token.NoPos - } - - file := p.prevFile - line := p.prevLine - delta := p.int() - line += delta - if p.version >= 5 { - if delta == deltaNewFile { - if n := p.int(); n >= 0 { - // file changed - file = p.path() - line = n - } - } - } else { - if delta == 0 { - if n := p.int(); n >= 0 { - // file changed - file = p.prevFile[:n] + p.string() - line = p.int() - } - } - } - p.prevFile = file - p.prevLine = line - - return p.fake.pos(file, line, 0) -} - // Synthesize a token.Pos type fakeFileSet struct { fset *token.FileSet @@ -389,205 +73,6 @@ var ( fakeLinesOnce sync.Once ) -func (p *importer) qualifiedName() (pkg *types.Package, name string) { - name = p.string() - pkg = p.pkg() - return -} - -func (p *importer) record(t types.Type) { - p.typList = append(p.typList, t) -} - -// A dddSlice is a types.Type representing ...T parameters. -// It only appears for parameter types and does not escape -// the importer. -type dddSlice struct { - elem types.Type -} - -func (t *dddSlice) Underlying() types.Type { return t } -func (t *dddSlice) String() string { return "..." + t.elem.String() } - -// parent is the package which declared the type; parent == nil means -// the package currently imported. The parent package is needed for -// exported struct fields and interface methods which don't contain -// explicit package information in the export data. -// -// A non-nil tname is used as the "owner" of the result type; i.e., -// the result type is the underlying type of tname. tname is used -// to give interface methods a named receiver type where possible. -func (p *importer) typ(parent *types.Package, tname *types.Named) types.Type { - // if the type was seen before, i is its index (>= 0) - i := p.tagOrIndex() - if i >= 0 { - return p.typList[i] - } - - // otherwise, i is the type tag (< 0) - switch i { - case namedTag: - // read type object - pos := p.pos() - parent, name := p.qualifiedName() - scope := parent.Scope() - obj := scope.Lookup(name) - - // if the object doesn't exist yet, create and insert it - if obj == nil { - obj = types.NewTypeName(pos, parent, name, nil) - scope.Insert(obj) - } - - if _, ok := obj.(*types.TypeName); !ok { - errorf("pkg = %s, name = %s => %s", parent, name, obj) - } - - // associate new named type with obj if it doesn't exist yet - t0 := types.NewNamed(obj.(*types.TypeName), nil, nil) - - // but record the existing type, if any - tname := obj.Type().(*types.Named) // tname is either t0 or the existing type - p.record(tname) - - // read underlying type - t0.SetUnderlying(p.typ(parent, t0)) - - // interfaces don't have associated methods - if types.IsInterface(t0) { - return tname - } - - // read associated methods - for i := p.int(); i > 0; i-- { - // TODO(gri) replace this with something closer to fieldName - pos := p.pos() - name := p.string() - if !exported(name) { - p.pkg() - } - - recv, _ := p.paramList() // TODO(gri) do we need a full param list for the receiver? - params, isddd := p.paramList() - result, _ := p.paramList() - p.int() // go:nointerface pragma - discarded - - sig := types.NewSignature(recv.At(0), params, result, isddd) - t0.AddMethod(types.NewFunc(pos, parent, name, sig)) - } - - return tname - - case arrayTag: - t := new(types.Array) - if p.trackAllTypes { - p.record(t) - } - - n := p.int64() - *t = *types.NewArray(p.typ(parent, nil), n) - return t - - case sliceTag: - t := new(types.Slice) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewSlice(p.typ(parent, nil)) - return t - - case dddTag: - t := new(dddSlice) - if p.trackAllTypes { - p.record(t) - } - - t.elem = p.typ(parent, nil) - return t - - case structTag: - t := new(types.Struct) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewStruct(p.fieldList(parent)) - return t - - case pointerTag: - t := new(types.Pointer) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewPointer(p.typ(parent, nil)) - return t - - case signatureTag: - t := new(types.Signature) - if p.trackAllTypes { - p.record(t) - } - - params, isddd := p.paramList() - result, _ := p.paramList() - *t = *types.NewSignature(nil, params, result, isddd) - return t - - case interfaceTag: - // Create a dummy entry in the type list. This is safe because we - // cannot expect the interface type to appear in a cycle, as any - // such cycle must contain a named type which would have been - // first defined earlier. - // TODO(gri) Is this still true now that we have type aliases? - // See issue #23225. - n := len(p.typList) - if p.trackAllTypes { - p.record(nil) - } - - var embeddeds []types.Type - for n := p.int(); n > 0; n-- { - p.pos() - embeddeds = append(embeddeds, p.typ(parent, nil)) - } - - t := newInterface(p.methodList(parent, tname), embeddeds) - p.interfaceList = append(p.interfaceList, t) - if p.trackAllTypes { - p.typList[n] = t - } - return t - - case mapTag: - t := new(types.Map) - if p.trackAllTypes { - p.record(t) - } - - key := p.typ(parent, nil) - val := p.typ(parent, nil) - *t = *types.NewMap(key, val) - return t - - case chanTag: - t := new(types.Chan) - if p.trackAllTypes { - p.record(t) - } - - dir := chanDir(p.int()) - val := p.typ(parent, nil) - *t = *types.NewChan(dir, val) - return t - - default: - errorf("unexpected type tag %d", i) // panics - panic("unreachable") - } -} - func chanDir(d int) types.ChanDir { // tag values must match the constants in cmd/compile/internal/gc/go.go switch d { @@ -603,394 +88,6 @@ func chanDir(d int) types.ChanDir { } } -func (p *importer) fieldList(parent *types.Package) (fields []*types.Var, tags []string) { - if n := p.int(); n > 0 { - fields = make([]*types.Var, n) - tags = make([]string, n) - for i := range fields { - fields[i], tags[i] = p.field(parent) - } - } - return -} - -func (p *importer) field(parent *types.Package) (*types.Var, string) { - pos := p.pos() - pkg, name, alias := p.fieldName(parent) - typ := p.typ(parent, nil) - tag := p.string() - - anonymous := false - if name == "" { - // anonymous field - typ must be T or *T and T must be a type name - switch typ := deref(typ).(type) { - case *types.Basic: // basic types are named types - pkg = nil // // objects defined in Universe scope have no package - name = typ.Name() - case *types.Named: - name = typ.Obj().Name() - default: - errorf("named base type expected") - } - anonymous = true - } else if alias { - // anonymous field: we have an explicit name because it's an alias - anonymous = true - } - - return types.NewField(pos, pkg, name, typ, anonymous), tag -} - -func (p *importer) methodList(parent *types.Package, baseType *types.Named) (methods []*types.Func) { - if n := p.int(); n > 0 { - methods = make([]*types.Func, n) - for i := range methods { - methods[i] = p.method(parent, baseType) - } - } - return -} - -func (p *importer) method(parent *types.Package, baseType *types.Named) *types.Func { - pos := p.pos() - pkg, name, _ := p.fieldName(parent) - // If we don't have a baseType, use a nil receiver. - // A receiver using the actual interface type (which - // we don't know yet) will be filled in when we call - // types.Interface.Complete. - var recv *types.Var - if baseType != nil { - recv = types.NewVar(token.NoPos, parent, "", baseType) - } - params, isddd := p.paramList() - result, _ := p.paramList() - sig := types.NewSignature(recv, params, result, isddd) - return types.NewFunc(pos, pkg, name, sig) -} - -func (p *importer) fieldName(parent *types.Package) (pkg *types.Package, name string, alias bool) { - name = p.string() - pkg = parent - if pkg == nil { - // use the imported package instead - pkg = p.pkgList[0] - } - if p.version == 0 && name == "_" { - // version 0 didn't export a package for _ fields - return - } - switch name { - case "": - // 1) field name matches base type name and is exported: nothing to do - case "?": - // 2) field name matches base type name and is not exported: need package - name = "" - pkg = p.pkg() - case "@": - // 3) field name doesn't match type name (alias) - name = p.string() - alias = true - fallthrough - default: - if !exported(name) { - pkg = p.pkg() - } - } - return -} - -func (p *importer) paramList() (*types.Tuple, bool) { - n := p.int() - if n == 0 { - return nil, false - } - // negative length indicates unnamed parameters - named := true - if n < 0 { - n = -n - named = false - } - // n > 0 - params := make([]*types.Var, n) - isddd := false - for i := range params { - params[i], isddd = p.param(named) - } - return types.NewTuple(params...), isddd -} - -func (p *importer) param(named bool) (*types.Var, bool) { - t := p.typ(nil, nil) - td, isddd := t.(*dddSlice) - if isddd { - t = types.NewSlice(td.elem) - } - - var pkg *types.Package - var name string - if named { - name = p.string() - if name == "" { - errorf("expected named parameter") - } - if name != "_" { - pkg = p.pkg() - } - if i := strings.Index(name, "·"); i > 0 { - name = name[:i] // cut off gc-specific parameter numbering - } - } - - // read and discard compiler-specific info - p.string() - - return types.NewVar(token.NoPos, pkg, name, t), isddd -} - -func exported(name string) bool { - ch, _ := utf8.DecodeRuneInString(name) - return unicode.IsUpper(ch) -} - -func (p *importer) value() constant.Value { - switch tag := p.tagOrIndex(); tag { - case falseTag: - return constant.MakeBool(false) - case trueTag: - return constant.MakeBool(true) - case int64Tag: - return constant.MakeInt64(p.int64()) - case floatTag: - return p.float() - case complexTag: - re := p.float() - im := p.float() - return constant.BinaryOp(re, token.ADD, constant.MakeImag(im)) - case stringTag: - return constant.MakeString(p.string()) - case unknownTag: - return constant.MakeUnknown() - default: - errorf("unexpected value tag %d", tag) // panics - panic("unreachable") - } -} - -func (p *importer) float() constant.Value { - sign := p.int() - if sign == 0 { - return constant.MakeInt64(0) - } - - exp := p.int() - mant := []byte(p.string()) // big endian - - // remove leading 0's if any - for len(mant) > 0 && mant[0] == 0 { - mant = mant[1:] - } - - // convert to little endian - // TODO(gri) go/constant should have a more direct conversion function - // (e.g., once it supports a big.Float based implementation) - for i, j := 0, len(mant)-1; i < j; i, j = i+1, j-1 { - mant[i], mant[j] = mant[j], mant[i] - } - - // adjust exponent (constant.MakeFromBytes creates an integer value, - // but mant represents the mantissa bits such that 0.5 <= mant < 1.0) - exp -= len(mant) << 3 - if len(mant) > 0 { - for msd := mant[len(mant)-1]; msd&0x80 == 0; msd <<= 1 { - exp++ - } - } - - x := constant.MakeFromBytes(mant) - switch { - case exp < 0: - d := constant.Shift(constant.MakeInt64(1), token.SHL, uint(-exp)) - x = constant.BinaryOp(x, token.QUO, d) - case exp > 0: - x = constant.Shift(x, token.SHL, uint(exp)) - } - - if sign < 0 { - x = constant.UnaryOp(token.SUB, x, 0) - } - return x -} - -// ---------------------------------------------------------------------------- -// Low-level decoders - -func (p *importer) tagOrIndex() int { - if p.debugFormat { - p.marker('t') - } - - return int(p.rawInt64()) -} - -func (p *importer) int() int { - x := p.int64() - if int64(int(x)) != x { - errorf("exported integer too large") - } - return int(x) -} - -func (p *importer) int64() int64 { - if p.debugFormat { - p.marker('i') - } - - return p.rawInt64() -} - -func (p *importer) path() string { - if p.debugFormat { - p.marker('p') - } - // if the path was seen before, i is its index (>= 0) - // (the empty string is at index 0) - i := p.rawInt64() - if i >= 0 { - return p.pathList[i] - } - // otherwise, i is the negative path length (< 0) - a := make([]string, -i) - for n := range a { - a[n] = p.string() - } - s := strings.Join(a, "/") - p.pathList = append(p.pathList, s) - return s -} - -func (p *importer) string() string { - if p.debugFormat { - p.marker('s') - } - // if the string was seen before, i is its index (>= 0) - // (the empty string is at index 0) - i := p.rawInt64() - if i >= 0 { - return p.strList[i] - } - // otherwise, i is the negative string length (< 0) - if n := int(-i); n <= cap(p.buf) { - p.buf = p.buf[:n] - } else { - p.buf = make([]byte, n) - } - for i := range p.buf { - p.buf[i] = p.rawByte() - } - s := string(p.buf) - p.strList = append(p.strList, s) - return s -} - -func (p *importer) marker(want byte) { - if got := p.rawByte(); got != want { - errorf("incorrect marker: got %c; want %c (pos = %d)", got, want, p.read) - } - - pos := p.read - if n := int(p.rawInt64()); n != pos { - errorf("incorrect position: got %d; want %d", n, pos) - } -} - -// rawInt64 should only be used by low-level decoders. -func (p *importer) rawInt64() int64 { - i, err := binary.ReadVarint(p) - if err != nil { - errorf("read error: %v", err) - } - return i -} - -// rawStringln should only be used to read the initial version string. -func (p *importer) rawStringln(b byte) string { - p.buf = p.buf[:0] - for b != '\n' { - p.buf = append(p.buf, b) - b = p.rawByte() - } - return string(p.buf) -} - -// needed for binary.ReadVarint in rawInt64 -func (p *importer) ReadByte() (byte, error) { - return p.rawByte(), nil -} - -// byte is the bottleneck interface for reading p.data. -// It unescapes '|' 'S' to '$' and '|' '|' to '|'. -// rawByte should only be used by low-level decoders. -func (p *importer) rawByte() byte { - b := p.data[0] - r := 1 - if b == '|' { - b = p.data[1] - r = 2 - switch b { - case 'S': - b = '$' - case '|': - // nothing to do - default: - errorf("unexpected escape sequence in export data") - } - } - p.data = p.data[r:] - p.read += r - return b - -} - -// ---------------------------------------------------------------------------- -// Export format - -// Tags. Must be < 0. -const ( - // Objects - packageTag = -(iota + 1) - constTag - typeTag - varTag - funcTag - endTag - - // Types - namedTag - arrayTag - sliceTag - dddTag - structTag - pointerTag - signatureTag - interfaceTag - mapTag - chanTag - - // Values - falseTag - trueTag - int64Tag - floatTag - fractionTag // not used by gc - complexTag - stringTag - nilTag // only used by gc (appears in exported inlined function bodies) - unknownTag // not used by gc (only appears in packages with errors) - - // Type aliases - aliasTag -) - var predeclOnce sync.Once var predecl []types.Type // initialized lazily diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go index 0372fb3..b122371 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go @@ -7,6 +7,18 @@ // Package gcimporter provides various functions for reading // gc-generated object files that can be used to implement the // Importer interface defined by the Go 1.5 standard library package. +// +// The encoding is deterministic: if the encoder is applied twice to +// the same types.Package data structure, both encodings are equal. +// This property may be important to avoid spurious changes in +// applications such as build systems. +// +// However, the encoder is not necessarily idempotent. Importing an +// exported package may yield a types.Package that, while it +// represents the same set of Go types as the original, may differ in +// the details of its internal representation. Because of these +// differences, re-encoding the imported package may yield a +// different, but equally valid, encoding of the package. package gcimporter // import "golang.org/x/tools/internal/gcimporter" import ( @@ -218,20 +230,17 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func // Or, define a new standard go/types/gcexportdata package. fset := token.NewFileSet() - // The indexed export format starts with an 'i'; the older - // binary export format starts with a 'c', 'd', or 'v' - // (from "version"). Select appropriate importer. + // Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'i': - _, pkg, err := IImportData(fset, packages, data[1:], id) - return pkg, err + case 'v', 'c', 'd': // binary, till go1.10 + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) - case 'v', 'c', 'd': - _, pkg, err := BImportData(fset, packages, data, id) + case 'i': // indexed, till go1.19 + _, pkg, err := IImportData(fset, packages, data[1:], id) return pkg, err - case 'u': + case 'u': // unified, from go1.20 _, pkg, err := UImportData(fset, packages, data[1:size], id) return pkg, err diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go index ba53cdc..6103dd7 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go @@ -22,17 +22,23 @@ import ( "strconv" "strings" + "golang.org/x/tools/go/types/objectpath" "golang.org/x/tools/internal/tokeninternal" "golang.org/x/tools/internal/typeparams" ) // IExportShallow encodes "shallow" export data for the specified package. // -// No promises are made about the encoding other than that it can be -// decoded by the same version of IIExportShallow. If you plan to save -// export data in the file system, be sure to include a cryptographic -// digest of the executable in the key to avoid version skew. -func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) { +// No promises are made about the encoding other than that it can be decoded by +// the same version of IIExportShallow. If you plan to save export data in the +// file system, be sure to include a cryptographic digest of the executable in +// the key to avoid version skew. +// +// If the provided reportf func is non-nil, it will be used for reporting bugs +// encountered during export. +// TODO(rfindley): remove reportf when we are confident enough in the new +// objectpath encoding. +func IExportShallow(fset *token.FileSet, pkg *types.Package, reportf ReportFunc) ([]byte, error) { // In principle this operation can only fail if out.Write fails, // but that's impossible for bytes.Buffer---and as a matter of // fact iexportCommon doesn't even check for I/O errors. @@ -44,22 +50,30 @@ func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) { return out.Bytes(), err } -// IImportShallow decodes "shallow" types.Package data encoded by IExportShallow -// in the same executable. This function cannot import data from +// IImportShallow decodes "shallow" types.Package data encoded by +// IExportShallow in the same executable. This function cannot import data from // cmd/compile or gcexportdata.Write. -func IImportShallow(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string, insert InsertType) (*types.Package, error) { +// +// The importer calls getPackages to obtain package symbols for all +// packages mentioned in the export data, including the one being +// decoded. +// +// If the provided reportf func is non-nil, it will be used for reporting bugs +// encountered during import. +// TODO(rfindley): remove reportf when we are confident enough in the new +// objectpath encoding. +func IImportShallow(fset *token.FileSet, getPackages GetPackagesFunc, data []byte, path string, reportf ReportFunc) (*types.Package, error) { const bundle = false - pkgs, err := iimportCommon(fset, imports, data, bundle, path, insert) + const shallow = true + pkgs, err := iimportCommon(fset, getPackages, data, bundle, path, shallow, reportf) if err != nil { return nil, err } return pkgs[0], nil } -// InsertType is the type of a function that creates a types.TypeName -// object for a named type and inserts it into the scope of the -// specified Package. -type InsertType = func(pkg *types.Package, name string) +// ReportFunc is the type of a function used to report formatted bugs. +type ReportFunc = func(string, ...interface{}) // Current bundled export format version. Increase with each format change. // 0: initial implementation @@ -313,8 +327,9 @@ type iexporter struct { out *bytes.Buffer version int - shallow bool // don't put types from other packages in the index - localpkg *types.Package // (nil in bundle mode) + shallow bool // don't put types from other packages in the index + objEncoder *objectpath.Encoder // encodes objects from other packages in shallow mode; lazily allocated + localpkg *types.Package // (nil in bundle mode) // allPkgs tracks all packages that have been referenced by // the export data, so we can ensure to include them in the @@ -354,6 +369,17 @@ func (p *iexporter) trace(format string, args ...interface{}) { fmt.Printf(strings.Repeat("..", p.indent)+format+"\n", args...) } +// objectpathEncoder returns the lazily allocated objectpath.Encoder to use +// when encoding objects in other packages during shallow export. +// +// Using a shared Encoder amortizes some of cost of objectpath search. +func (p *iexporter) objectpathEncoder() *objectpath.Encoder { + if p.objEncoder == nil { + p.objEncoder = new(objectpath.Encoder) + } + return p.objEncoder +} + // stringOff returns the offset of s within the string section. // If not already present, it's added to the end. func (p *iexporter) stringOff(s string) uint64 { @@ -413,7 +439,6 @@ type exportWriter struct { p *iexporter data intWriter - currPkg *types.Package prevFile string prevLine int64 prevColumn int64 @@ -436,7 +461,6 @@ func (p *iexporter) doDecl(obj types.Object) { }() } w := p.newWriter() - w.setPkg(obj.Pkg(), false) switch obj := obj.(type) { case *types.Var: @@ -673,6 +697,9 @@ func (w *exportWriter) qualifiedType(obj *types.TypeName) { w.pkg(obj.Pkg()) } +// TODO(rfindley): what does 'pkg' even mean here? It would be better to pass +// it in explicitly into signatures and structs that may use it for +// constructing fields. func (w *exportWriter) typ(t types.Type, pkg *types.Package) { w.data.uint64(w.p.typOff(t, pkg)) } @@ -764,30 +791,53 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { case *types.Signature: w.startType(signatureType) - w.setPkg(pkg, true) + w.pkg(pkg) w.signature(t) case *types.Struct: w.startType(structType) n := t.NumFields() + // Even for struct{} we must emit some qualifying package, because that's + // what the compiler does, and thus that's what the importer expects. + fieldPkg := pkg if n > 0 { - w.setPkg(t.Field(0).Pkg(), true) // qualifying package for field objects - } else { - w.setPkg(pkg, true) + fieldPkg = t.Field(0).Pkg() + } + if fieldPkg == nil { + // TODO(rfindley): improve this very hacky logic. + // + // The importer expects a package to be set for all struct types, even + // those with no fields. A better encoding might be to set NumFields + // before pkg. setPkg panics with a nil package, which may be possible + // to reach with invalid packages (and perhaps valid packages, too?), so + // (arbitrarily) set the localpkg if available. + // + // Alternatively, we may be able to simply guarantee that pkg != nil, by + // reconsidering the encoding of constant values. + if w.p.shallow { + fieldPkg = w.p.localpkg + } else { + panic(internalErrorf("no package to set for empty struct")) + } } + w.pkg(fieldPkg) w.uint64(uint64(n)) + for i := 0; i < n; i++ { f := t.Field(i) + if w.p.shallow { + w.objectPath(f) + } w.pos(f.Pos()) w.string(f.Name()) // unexported fields implicitly qualified by prior setPkg - w.typ(f.Type(), pkg) + w.typ(f.Type(), fieldPkg) w.bool(f.Anonymous()) w.string(t.Tag(i)) // note (or tag) } case *types.Interface: w.startType(interfaceType) - w.setPkg(pkg, true) + w.pkg(pkg) n := t.NumEmbeddeds() w.uint64(uint64(n)) @@ -802,10 +852,16 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { w.typ(ft, tPkg) } + // See comment for struct fields. In shallow mode we change the encoding + // for interface methods that are promoted from other packages. + n = t.NumExplicitMethods() w.uint64(uint64(n)) for i := 0; i < n; i++ { m := t.ExplicitMethod(i) + if w.p.shallow { + w.objectPath(m) + } w.pos(m.Pos()) w.string(m.Name()) sig, _ := m.Type().(*types.Signature) @@ -827,12 +883,61 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { } } -func (w *exportWriter) setPkg(pkg *types.Package, write bool) { - if write { - w.pkg(pkg) +// objectPath writes the package and objectPath to use to look up obj in a +// different package, when encoding in "shallow" mode. +// +// When doing a shallow import, the importer creates only the local package, +// and requests package symbols for dependencies from the client. +// However, certain types defined in the local package may hold objects defined +// (perhaps deeply) within another package. +// +// For example, consider the following: +// +// package a +// func F() chan * map[string] struct { X int } +// +// package b +// import "a" +// var B = a.F() +// +// In this example, the type of b.B holds fields defined in package a. +// In order to have the correct canonical objects for the field defined in the +// type of B, they are encoded as objectPaths and later looked up in the +// importer. The same problem applies to interface methods. +func (w *exportWriter) objectPath(obj types.Object) { + if obj.Pkg() == nil || obj.Pkg() == w.p.localpkg { + // obj.Pkg() may be nil for the builtin error.Error. + // In this case, or if obj is declared in the local package, no need to + // encode. + w.string("") + return } - - w.currPkg = pkg + objectPath, err := w.p.objectpathEncoder().For(obj) + if err != nil { + // Fall back to the empty string, which will cause the importer to create a + // new object, which matches earlier behavior. Creating a new object is + // sufficient for many purposes (such as type checking), but causes certain + // references algorithms to fail (golang/go#60819). However, we didn't + // notice this problem during months of gopls@v0.12.0 testing. + // + // TODO(golang/go#61674): this workaround is insufficient, as in the case + // where the field forwarded from an instantiated type that may not appear + // in the export data of the original package: + // + // // package a + // type A[P any] struct{ F P } + // + // // package b + // type B a.A[int] + // + // We need to update references algorithms not to depend on this + // de-duplication, at which point we may want to simply remove the + // workaround here. + w.string("") + return + } + w.string(string(objectPath)) + w.pkg(obj.Pkg()) } func (w *exportWriter) signature(sig *types.Signature) { @@ -913,6 +1018,17 @@ func (w *exportWriter) value(typ types.Type, v constant.Value) { w.int64(int64(v.Kind())) } + if v.Kind() == constant.Unknown { + // golang/go#60605: treat unknown constant values as if they have invalid type + // + // This loses some fidelity over the package type-checked from source, but that + // is acceptable. + // + // TODO(rfindley): we should switch on the recorded constant kind rather + // than the constant type + return + } + switch b := typ.Underlying().(*types.Basic); b.Info() & types.IsConstType { case types.IsBoolean: w.bool(constant.BoolVal(v)) @@ -969,6 +1085,16 @@ func constantToFloat(x constant.Value) *big.Float { return &f } +func valueToRat(x constant.Value) *big.Rat { + // Convert little-endian to big-endian. + // I can't believe this is necessary. + bytes := constant.Bytes(x) + for i := 0; i < len(bytes)/2; i++ { + bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i] + } + return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes)) +} + // mpint exports a multi-precision integer. // // For unsigned types, small values are written out as a single @@ -1178,3 +1304,19 @@ func (q *objQueue) popHead() types.Object { q.head++ return obj } + +// internalError represents an error generated inside this package. +type internalError string + +func (e internalError) Error() string { return "gcimporter: " + string(e) } + +// TODO(adonovan): make this call panic, so that it's symmetric with errorf. +// Otherwise it's easy to forget to do anything with the error. +// +// TODO(adonovan): also, consider switching the names "errorf" and +// "internalErrorf" as the former is used for bugs, whose cause is +// internal inconsistency, whereas the latter is used for ordinary +// situations like bad input, whose cause is external. +func internalErrorf(format string, args ...interface{}) error { + return internalError(fmt.Sprintf(format, args...)) +} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go index 448f903..8e64cf6 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go @@ -21,6 +21,7 @@ import ( "sort" "strings" + "golang.org/x/tools/go/types/objectpath" "golang.org/x/tools/internal/typeparams" ) @@ -85,7 +86,7 @@ const ( // If the export data version is not recognized or the format is otherwise // compromised, an error is returned. func IImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (int, *types.Package, error) { - pkgs, err := iimportCommon(fset, imports, data, false, path, nil) + pkgs, err := iimportCommon(fset, GetPackagesFromMap(imports), data, false, path, false, nil) if err != nil { return 0, nil, err } @@ -94,10 +95,49 @@ func IImportData(fset *token.FileSet, imports map[string]*types.Package, data [] // IImportBundle imports a set of packages from the serialized package bundle. func IImportBundle(fset *token.FileSet, imports map[string]*types.Package, data []byte) ([]*types.Package, error) { - return iimportCommon(fset, imports, data, true, "", nil) + return iimportCommon(fset, GetPackagesFromMap(imports), data, true, "", false, nil) } -func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data []byte, bundle bool, path string, insert InsertType) (pkgs []*types.Package, err error) { +// A GetPackagesFunc function obtains the non-nil symbols for a set of +// packages, creating and recursively importing them as needed. An +// implementation should store each package symbol is in the Pkg +// field of the items array. +// +// Any error causes importing to fail. This can be used to quickly read +// the import manifest of an export data file without fully decoding it. +type GetPackagesFunc = func(items []GetPackagesItem) error + +// A GetPackagesItem is a request from the importer for the package +// symbol of the specified name and path. +type GetPackagesItem struct { + Name, Path string + Pkg *types.Package // to be filled in by GetPackagesFunc call + + // private importer state + pathOffset uint64 + nameIndex map[string]uint64 +} + +// GetPackagesFromMap returns a GetPackagesFunc that retrieves +// packages from the given map of package path to package. +// +// The returned function may mutate m: each requested package that is not +// found is created with types.NewPackage and inserted into m. +func GetPackagesFromMap(m map[string]*types.Package) GetPackagesFunc { + return func(items []GetPackagesItem) error { + for i, item := range items { + pkg, ok := m[item.Path] + if !ok { + pkg = types.NewPackage(item.Path, item.Name) + m[item.Path] = pkg + } + items[i].Pkg = pkg + } + return nil + } +} + +func iimportCommon(fset *token.FileSet, getPackages GetPackagesFunc, data []byte, bundle bool, path string, shallow bool, reportf ReportFunc) (pkgs []*types.Package, err error) { const currentVersion = iexportVersionCurrent version := int64(-1) if !debug { @@ -108,7 +148,7 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data } else if version > currentVersion { err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e) } else { - err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e) + err = fmt.Errorf("internal error while importing %q (%v); please report an issue", path, e) } } }() @@ -117,11 +157,8 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data r := &intReader{bytes.NewReader(data), path} if bundle { - bundleVersion := r.uint64() - switch bundleVersion { - case bundleVersion: - default: - errorf("unknown bundle format version %d", bundleVersion) + if v := r.uint64(); v != bundleVersion { + errorf("unknown bundle format version %d", v) } } @@ -139,7 +176,7 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data sLen := int64(r.uint64()) var fLen int64 var fileOffset []uint64 - if insert != nil { + if shallow { // Shallow mode uses a different position encoding. fLen = int64(r.uint64()) fileOffset = make([]uint64, r.uint64()) @@ -158,7 +195,8 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data p := iimporter{ version: int(version), ipath: path, - insert: insert, + shallow: shallow, + reportf: reportf, stringData: stringData, stringCache: make(map[uint64]string), @@ -185,8 +223,9 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data p.typCache[uint64(i)] = pt } - pkgList := make([]*types.Package, r.uint64()) - for i := range pkgList { + // Gather the relevant packages from the manifest. + items := make([]GetPackagesItem, r.uint64()) + for i := range items { pkgPathOff := r.uint64() pkgPath := p.stringAt(pkgPathOff) pkgName := p.stringAt(r.uint64()) @@ -195,30 +234,42 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data if pkgPath == "" { pkgPath = path } - pkg := imports[pkgPath] - if pkg == nil { - pkg = types.NewPackage(pkgPath, pkgName) - imports[pkgPath] = pkg - } else if pkg.Name() != pkgName { - errorf("conflicting names %s and %s for package %q", pkg.Name(), pkgName, path) - } - if i == 0 && !bundle { - p.localpkg = pkg - } - - p.pkgCache[pkgPathOff] = pkg + items[i].Name = pkgName + items[i].Path = pkgPath + items[i].pathOffset = pkgPathOff // Read index for package. nameIndex := make(map[string]uint64) nSyms := r.uint64() - // In shallow mode we don't expect an index for other packages. - assert(nSyms == 0 || p.localpkg == pkg || p.insert == nil) + // In shallow mode, only the current package (i=0) has an index. + assert(!(shallow && i > 0 && nSyms != 0)) for ; nSyms > 0; nSyms-- { name := p.stringAt(r.uint64()) nameIndex[name] = r.uint64() } - p.pkgIndex[pkg] = nameIndex + items[i].nameIndex = nameIndex + } + + // Request packages all at once from the client, + // enabling a parallel implementation. + if err := getPackages(items); err != nil { + return nil, err // don't wrap this error + } + + // Check the results and complete the index. + pkgList := make([]*types.Package, len(items)) + for i, item := range items { + pkg := item.Pkg + if pkg == nil { + errorf("internal error: getPackages returned nil package for %q", item.Path) + } else if pkg.Path() != item.Path { + errorf("internal error: getPackages returned wrong path %q, want %q", pkg.Path(), item.Path) + } else if pkg.Name() != item.Name { + errorf("internal error: getPackages returned wrong name %s for package %q, want %s", pkg.Name(), item.Path, item.Name) + } + p.pkgCache[item.pathOffset] = pkg + p.pkgIndex[pkg] = item.nameIndex pkgList[i] = pkg } @@ -277,6 +328,13 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data typ.Complete() } + // Workaround for golang/go#61561. See the doc for instanceList for details. + for _, typ := range p.instanceList { + if iface, _ := typ.Underlying().(*types.Interface); iface != nil { + iface.Complete() + } + } + return pkgs, nil } @@ -289,8 +347,8 @@ type iimporter struct { version int ipath string - localpkg *types.Package - insert func(pkg *types.Package, name string) // "shallow" mode only + shallow bool + reportf ReportFunc // if non-nil, used to report bugs stringData []byte stringCache map[uint64]string @@ -307,6 +365,12 @@ type iimporter struct { fake fakeFileSet interfaceList []*types.Interface + // Workaround for the go/types bug golang/go#61561: instances produced during + // instantiation may contain incomplete interfaces. Here we only complete the + // underlying type of the instance, which is the most common case but doesn't + // handle parameterized interface literals defined deeper in the type. + instanceList []types.Type // instances for later completion (see golang/go#61561) + // Arguments for calls to SetConstraint that are deferred due to recursive types later []setConstraintArgs @@ -338,13 +402,9 @@ func (p *iimporter) doDecl(pkg *types.Package, name string) { off, ok := p.pkgIndex[pkg][name] if !ok { - // In "shallow" mode, call back to the application to - // find the object and insert it into the package scope. - if p.insert != nil { - assert(pkg != p.localpkg) - p.insert(pkg, name) // "can't fail" - return - } + // In deep mode, the index should be complete. In shallow + // mode, we should have already recursively loaded necessary + // dependencies so the above Lookup succeeds. errorf("%v.%v not in index", pkg, name) } @@ -711,7 +771,8 @@ func (r *importReader) qualifiedIdent() (*types.Package, string) { } func (r *importReader) pos() token.Pos { - if r.p.insert != nil { // shallow mode + if r.p.shallow { + // precise offsets are encoded only in shallow mode return r.posv2() } if r.p.version >= iexportVersionPosCol { @@ -812,13 +873,28 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { fields := make([]*types.Var, r.uint64()) tags := make([]string, len(fields)) for i := range fields { + var field *types.Var + if r.p.shallow { + field, _ = r.objectPathObject().(*types.Var) + } + fpos := r.pos() fname := r.ident() ftyp := r.typ() emb := r.bool() tag := r.string() - fields[i] = types.NewField(fpos, r.currPkg, fname, ftyp, emb) + // Either this is not a shallow import, the field is local, or the + // encoded objectPath failed to produce an object (a bug). + // + // Even in this last, buggy case, fall back on creating a new field. As + // discussed in iexport.go, this is not correct, but mostly works and is + // preferable to failing (for now at least). + if field == nil { + field = types.NewField(fpos, r.currPkg, fname, ftyp, emb) + } + + fields[i] = field tags[i] = tag } return types.NewStruct(fields, tags) @@ -834,6 +910,11 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { methods := make([]*types.Func, r.uint64()) for i := range methods { + var method *types.Func + if r.p.shallow { + method, _ = r.objectPathObject().(*types.Func) + } + mpos := r.pos() mname := r.ident() @@ -843,9 +924,12 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { if base != nil { recv = types.NewVar(token.NoPos, r.currPkg, "", base) } - msig := r.signature(recv, nil, nil) - methods[i] = types.NewFunc(mpos, r.currPkg, mname, msig) + + if method == nil { + method = types.NewFunc(mpos, r.currPkg, mname, msig) + } + methods[i] = method } typ := newInterface(methods, embeddeds) @@ -883,6 +967,9 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { // we must always use the methods of the base (orig) type. // TODO provide a non-nil *Environment t, _ := typeparams.Instantiate(nil, baseType, targs, false) + + // Workaround for golang/go#61561. See the doc for instanceList for details. + r.p.instanceList = append(r.p.instanceList, t) return t case unionType: @@ -901,6 +988,26 @@ func (r *importReader) kind() itag { return itag(r.uint64()) } +// objectPathObject is the inverse of exportWriter.objectPath. +// +// In shallow mode, certain fields and methods may need to be looked up in an +// imported package. See the doc for exportWriter.objectPath for a full +// explanation. +func (r *importReader) objectPathObject() types.Object { + objPath := objectpath.Path(r.string()) + if objPath == "" { + return nil + } + pkg := r.pkg() + obj, err := objectpath.Object(pkg, objPath) + if err != nil { + if r.p.reportf != nil { + r.p.reportf("failed to find object for objectPath %q: %v", objPath, err) + } + } + return obj +} + func (r *importReader) signature(recv *types.Var, rparams []*typeparams.TypeParam, tparams []*typeparams.TypeParam) *types.Signature { params := r.paramList() results := r.paramList() diff --git a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go index b285a11..b977435 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go @@ -10,8 +10,10 @@ package gcimporter import ( + "fmt" "go/token" "go/types" + "sort" "strings" "golang.org/x/tools/internal/pkgbits" @@ -62,6 +64,14 @@ type typeInfo struct { } func UImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { + if !debug { + defer func() { + if x := recover(); x != nil { + err = fmt.Errorf("internal error in importing %q (%v); please report an issue", path, x) + } + }() + } + s := string(data) s = s[:strings.LastIndex(s, "\n$$\n")] input := pkgbits.NewPkgDecoder(path, s) @@ -121,6 +131,16 @@ func readUnifiedPackage(fset *token.FileSet, ctxt *types.Context, imports map[st iface.Complete() } + // Imports() of pkg are all of the transitive packages that were loaded. + var imps []*types.Package + for _, imp := range pr.pkgs { + if imp != nil && imp != pkg { + imps = append(imps, imp) + } + } + sort.Sort(byPath(imps)) + pkg.SetImports(imps) + pkg.MarkComplete() return pkg } @@ -260,39 +280,9 @@ func (r *reader) doPkg() *types.Package { pkg := types.NewPackage(path, name) r.p.imports[path] = pkg - imports := make([]*types.Package, r.Len()) - for i := range imports { - imports[i] = r.pkg() - } - pkg.SetImports(flattenImports(imports)) - return pkg } -// flattenImports returns the transitive closure of all imported -// packages rooted from pkgs. -func flattenImports(pkgs []*types.Package) []*types.Package { - var res []*types.Package - seen := make(map[*types.Package]struct{}) - for _, pkg := range pkgs { - if _, ok := seen[pkg]; ok { - continue - } - seen[pkg] = struct{}{} - res = append(res, pkg) - - // pkg.Imports() is already flattened. - for _, pkg := range pkg.Imports() { - if _, ok := seen[pkg]; ok { - continue - } - seen[pkg] = struct{}{} - res = append(res, pkg) - } - } - return res -} - // @@@ Types func (r *reader) typ() types.Type { diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go index d505516..53cf66d 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go +++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go @@ -8,10 +8,12 @@ package gocommand import ( "bytes" "context" + "errors" "fmt" "io" "log" "os" + "reflect" "regexp" "runtime" "strconv" @@ -22,6 +24,9 @@ import ( exec "golang.org/x/sys/execabs" "golang.org/x/tools/internal/event" + "golang.org/x/tools/internal/event/keys" + "golang.org/x/tools/internal/event/label" + "golang.org/x/tools/internal/event/tag" ) // An Runner will run go command invocations and serialize @@ -51,9 +56,19 @@ func (runner *Runner) initialize() { // 1.14: go: updating go.mod: existing contents have changed since last read var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`) +// verb is an event label for the go command verb. +var verb = keys.NewString("verb", "go command verb") + +func invLabels(inv Invocation) []label.Label { + return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)} +} + // Run is a convenience wrapper around RunRaw. // It returns only stdout and a "friendly" error. func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.Run", invLabels(inv)...) + defer done() + stdout, _, friendly, _ := runner.RunRaw(ctx, inv) return stdout, friendly } @@ -61,6 +76,9 @@ func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, e // RunPiped runs the invocation serially, always waiting for any concurrent // invocations to complete first. func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) error { + ctx, done := event.Start(ctx, "gocommand.Runner.RunPiped", invLabels(inv)...) + defer done() + _, err := runner.runPiped(ctx, inv, stdout, stderr) return err } @@ -68,6 +86,8 @@ func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stde // RunRaw runs the invocation, serializing requests only if they fight over // go.mod changes. func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...) + defer done() // Make sure the runner is always initialized. runner.initialize() @@ -215,6 +235,18 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error { cmd := exec.Command("go", goArgs...) cmd.Stdout = stdout cmd.Stderr = stderr + + // cmd.WaitDelay was added only in go1.20 (see #50436). + if waitDelay := reflect.ValueOf(cmd).Elem().FieldByName("WaitDelay"); waitDelay.IsValid() { + // https://go.dev/issue/59541: don't wait forever copying stderr + // after the command has exited. + // After CL 484741 we copy stdout manually, so we we'll stop reading that as + // soon as ctx is done. However, we also don't want to wait around forever + // for stderr. Give a much-longer-than-reasonable delay and then assume that + // something has wedged in the kernel or runtime. + waitDelay.Set(reflect.ValueOf(30 * time.Second)) + } + // On darwin the cwd gets resolved to the real path, which breaks anything that // expects the working directory to keep the original path, including the // go command when dealing with modules. @@ -229,6 +261,7 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error { cmd.Env = append(cmd.Env, "PWD="+i.WorkingDir) cmd.Dir = i.WorkingDir } + defer func(start time.Time) { log("%s for %v", time.Since(start), cmdDebugStr(cmd)) }(time.Now()) return runCmdContext(ctx, cmd) @@ -242,10 +275,85 @@ var DebugHangingGoCommands = false // runCmdContext is like exec.CommandContext except it sends os.Interrupt // before os.Kill. -func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { - if err := cmd.Start(); err != nil { +func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) { + // If cmd.Stdout is not an *os.File, the exec package will create a pipe and + // copy it to the Writer in a goroutine until the process has finished and + // either the pipe reaches EOF or command's WaitDelay expires. + // + // However, the output from 'go list' can be quite large, and we don't want to + // keep reading (and allocating buffers) if we've already decided we don't + // care about the output. We don't want to wait for the process to finish, and + // we don't wait to wait for the WaitDelay to expire either. + // + // Instead, if cmd.Stdout requires a copying goroutine we explicitly replace + // it with a pipe (which is an *os.File), which we can close in order to stop + // copying output as soon as we realize we don't care about it. + var stdoutW *os.File + if cmd.Stdout != nil { + if _, ok := cmd.Stdout.(*os.File); !ok { + var stdoutR *os.File + stdoutR, stdoutW, err = os.Pipe() + if err != nil { + return err + } + prevStdout := cmd.Stdout + cmd.Stdout = stdoutW + + stdoutErr := make(chan error, 1) + go func() { + _, err := io.Copy(prevStdout, stdoutR) + if err != nil { + err = fmt.Errorf("copying stdout: %w", err) + } + stdoutErr <- err + }() + defer func() { + // We started a goroutine to copy a stdout pipe. + // Wait for it to finish, or terminate it if need be. + var err2 error + select { + case err2 = <-stdoutErr: + stdoutR.Close() + case <-ctx.Done(): + stdoutR.Close() + // Per https://pkg.go.dev/os#File.Close, the call to stdoutR.Close + // should cause the Read call in io.Copy to unblock and return + // immediately, but we still need to receive from stdoutErr to confirm + // that it has happened. + <-stdoutErr + err2 = ctx.Err() + } + if err == nil { + err = err2 + } + }() + + // Per https://pkg.go.dev/os/exec#Cmd, “If Stdout and Stderr are the + // same writer, and have a type that can be compared with ==, at most + // one goroutine at a time will call Write.” + // + // Since we're starting a goroutine that writes to cmd.Stdout, we must + // also update cmd.Stderr so that it still holds. + func() { + defer func() { recover() }() + if cmd.Stderr == prevStdout { + cmd.Stderr = cmd.Stdout + } + }() + } + } + + err = cmd.Start() + if stdoutW != nil { + // The child process has inherited the pipe file, + // so close the copy held in this process. + stdoutW.Close() + stdoutW = nil + } + if err != nil { return err } + resChan := make(chan error, 1) go func() { resChan <- cmd.Wait() @@ -253,11 +361,14 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { // If we're interested in debugging hanging Go commands, stop waiting after a // minute and panic with interesting information. - if DebugHangingGoCommands { + debug := DebugHangingGoCommands + if debug { + timer := time.NewTimer(1 * time.Minute) + defer timer.Stop() select { case err := <-resChan: return err - case <-time.After(1 * time.Minute): + case <-timer.C: HandleHangingGoCommand(cmd.Process) case <-ctx.Done(): } @@ -270,30 +381,25 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { } // Cancelled. Interrupt and see if it ends voluntarily. - cmd.Process.Signal(os.Interrupt) - select { - case err := <-resChan: - return err - case <-time.After(time.Second): + if err := cmd.Process.Signal(os.Interrupt); err == nil { + // (We used to wait only 1s but this proved + // fragile on loaded builder machines.) + timer := time.NewTimer(5 * time.Second) + defer timer.Stop() + select { + case err := <-resChan: + return err + case <-timer.C: + } } // Didn't shut down in response to interrupt. Kill it hard. // TODO(rfindley): per advice from bcmills@, it may be better to send SIGQUIT // on certain platforms, such as unix. - if err := cmd.Process.Kill(); err != nil && DebugHangingGoCommands { - // Don't panic here as this reliably fails on windows with EINVAL. + if err := cmd.Process.Kill(); err != nil && !errors.Is(err, os.ErrProcessDone) && debug { log.Printf("error killing the Go command: %v", err) } - // See above: don't wait indefinitely if we're debugging hanging Go commands. - if DebugHangingGoCommands { - select { - case err := <-resChan: - return err - case <-time.After(10 * time.Second): // a shorter wait as resChan should return quickly following Kill - HandleHangingGoCommand(cmd.Process) - } - } return <-resChan } diff --git a/vendor/golang.org/x/tools/internal/gocommand/version.go b/vendor/golang.org/x/tools/internal/gocommand/version.go index 307a76d..446c584 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/version.go +++ b/vendor/golang.org/x/tools/internal/gocommand/version.go @@ -23,21 +23,11 @@ import ( func GoVersion(ctx context.Context, inv Invocation, r *Runner) (int, error) { inv.Verb = "list" inv.Args = []string{"-e", "-f", `{{context.ReleaseTags}}`, `--`, `unsafe`} - inv.Env = append(append([]string{}, inv.Env...), "GO111MODULE=off") - // Unset any unneeded flags, and remove them from BuildFlags, if they're - // present. - inv.ModFile = "" + inv.BuildFlags = nil // This is not a build command. inv.ModFlag = "" - var buildFlags []string - for _, flag := range inv.BuildFlags { - // Flags can be prefixed by one or two dashes. - f := strings.TrimPrefix(strings.TrimPrefix(flag, "-"), "-") - if strings.HasPrefix(f, "mod=") || strings.HasPrefix(f, "modfile=") { - continue - } - buildFlags = append(buildFlags, flag) - } - inv.BuildFlags = buildFlags + inv.ModFile = "" + inv.Env = append(inv.Env[:len(inv.Env):len(inv.Env)], "GO111MODULE=off") + stdoutBytes, err := r.Run(ctx, inv) if err != nil { return 0, err diff --git a/vendor/golang.org/x/tools/internal/gopathwalk/walk.go b/vendor/golang.org/x/tools/internal/gopathwalk/walk.go index 1684053..452e342 100644 --- a/vendor/golang.org/x/tools/internal/gopathwalk/walk.go +++ b/vendor/golang.org/x/tools/internal/gopathwalk/walk.go @@ -9,8 +9,6 @@ package gopathwalk import ( "bufio" "bytes" - "fmt" - "io/ioutil" "log" "os" "path/filepath" @@ -78,7 +76,7 @@ func walkDir(root Root, add func(Root, string), skip func(root Root, dir string) } start := time.Now() if opts.Logf != nil { - opts.Logf("gopathwalk: scanning %s", root.Path) + opts.Logf("scanning %s", root.Path) } w := &walker{ root: root, @@ -88,11 +86,15 @@ func walkDir(root Root, add func(Root, string), skip func(root Root, dir string) } w.init() if err := fastwalk.Walk(root.Path, w.walk); err != nil { - log.Printf("gopathwalk: scanning directory %v: %v", root.Path, err) + logf := opts.Logf + if logf == nil { + logf = log.Printf + } + logf("scanning directory %v: %v", root.Path, err) } if opts.Logf != nil { - opts.Logf("gopathwalk: scanned %s in %v", root.Path, time.Since(start)) + opts.Logf("scanned %s in %v", root.Path, time.Since(start)) } } @@ -135,7 +137,7 @@ func (w *walker) init() { // The provided path is one of the $GOPATH entries with "src" appended. func (w *walker) getIgnoredDirs(path string) []string { file := filepath.Join(path, ".goimportsignore") - slurp, err := ioutil.ReadFile(file) + slurp, err := os.ReadFile(file) if w.opts.Logf != nil { if err != nil { w.opts.Logf("%v", err) @@ -222,7 +224,11 @@ func (w *walker) walk(path string, typ os.FileMode) error { func (w *walker) shouldTraverse(path string) bool { ts, err := os.Stat(path) if err != nil { - fmt.Fprintln(os.Stderr, err) + logf := w.opts.Logf + if logf == nil { + logf = log.Printf + } + logf("%v", err) return false } if !ts.IsDir() { diff --git a/vendor/golang.org/x/tools/internal/imports/fix.go b/vendor/golang.org/x/tools/internal/imports/fix.go index 642a5ac..d4f1b4e 100644 --- a/vendor/golang.org/x/tools/internal/imports/fix.go +++ b/vendor/golang.org/x/tools/internal/imports/fix.go @@ -26,6 +26,7 @@ import ( "unicode/utf8" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/gopathwalk" ) @@ -414,9 +415,16 @@ func (p *pass) fix() ([]*ImportFix, bool) { }) } } + // Collecting fixes involved map iteration, so sort for stability. See + // golang/go#59976. + sortFixes(fixes) + // collect selected fixes in a separate slice, so that it can be sorted + // separately. Note that these fixes must occur after fixes to existing + // imports. TODO(rfindley): figure out why. + var selectedFixes []*ImportFix for _, imp := range selected { - fixes = append(fixes, &ImportFix{ + selectedFixes = append(selectedFixes, &ImportFix{ StmtInfo: ImportInfo{ Name: p.importSpecName(imp), ImportPath: imp.ImportPath, @@ -425,8 +433,25 @@ func (p *pass) fix() ([]*ImportFix, bool) { FixType: AddImport, }) } + sortFixes(selectedFixes) - return fixes, true + return append(fixes, selectedFixes...), true +} + +func sortFixes(fixes []*ImportFix) { + sort.Slice(fixes, func(i, j int) bool { + fi, fj := fixes[i], fixes[j] + if fi.StmtInfo.ImportPath != fj.StmtInfo.ImportPath { + return fi.StmtInfo.ImportPath < fj.StmtInfo.ImportPath + } + if fi.StmtInfo.Name != fj.StmtInfo.Name { + return fi.StmtInfo.Name < fj.StmtInfo.Name + } + if fi.IdentName != fj.IdentName { + return fi.IdentName < fj.IdentName + } + return fi.FixType < fj.FixType + }) } // importSpecName gets the import name of imp in the import spec. @@ -519,7 +544,7 @@ func (p *pass) addCandidate(imp *ImportInfo, pkg *packageInfo) { var fixImports = fixImportsDefault func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) error { - fixes, err := getFixes(fset, f, filename, env) + fixes, err := getFixes(context.Background(), fset, f, filename, env) if err != nil { return err } @@ -529,7 +554,7 @@ func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *P // getFixes gets the import fixes that need to be made to f in order to fix the imports. // It does not modify the ast. -func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { +func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { abs, err := filepath.Abs(filename) if err != nil { return nil, err @@ -583,7 +608,7 @@ func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv // Go look for candidates in $GOPATH, etc. We don't necessarily load // the real exports of sibling imports, so keep assuming their contents. - if err := addExternalCandidates(p, p.missingRefs, filename); err != nil { + if err := addExternalCandidates(ctx, p, p.missingRefs, filename); err != nil { return nil, err } @@ -1031,7 +1056,10 @@ type scanCallback struct { exportsLoaded func(pkg *pkg, exports []string) } -func addExternalCandidates(pass *pass, refs references, filename string) error { +func addExternalCandidates(ctx context.Context, pass *pass, refs references, filename string) error { + ctx, done := event.Start(ctx, "imports.addExternalCandidates") + defer done() + var mu sync.Mutex found := make(map[string][]pkgDistance) callback := &scanCallback{ diff --git a/vendor/golang.org/x/tools/internal/imports/imports.go b/vendor/golang.org/x/tools/internal/imports/imports.go index 95a8838..58e637b 100644 --- a/vendor/golang.org/x/tools/internal/imports/imports.go +++ b/vendor/golang.org/x/tools/internal/imports/imports.go @@ -11,6 +11,7 @@ package imports import ( "bufio" "bytes" + "context" "fmt" "go/ast" "go/format" @@ -23,6 +24,7 @@ import ( "strings" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/event" ) // Options is golang.org/x/tools/imports.Options with extra internal-only options. @@ -66,14 +68,17 @@ func Process(filename string, src []byte, opt *Options) (formatted []byte, err e // // Note that filename's directory influences which imports can be chosen, // so it is important that filename be accurate. -func FixImports(filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { +func FixImports(ctx context.Context, filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { + ctx, done := event.Start(ctx, "imports.FixImports") + defer done() + fileSet := token.NewFileSet() file, _, err := parse(fileSet, filename, src, opt) if err != nil { return nil, err } - return getFixes(fileSet, file, filename, opt.Env) + return getFixes(ctx, fileSet, file, filename, opt.Env) } // ApplyFixes applies all of the fixes to the file and formats it. extraMode diff --git a/vendor/golang.org/x/tools/internal/imports/mod.go b/vendor/golang.org/x/tools/internal/imports/mod.go index 7d99d04..977d238 100644 --- a/vendor/golang.org/x/tools/internal/imports/mod.go +++ b/vendor/golang.org/x/tools/internal/imports/mod.go @@ -19,6 +19,7 @@ import ( "strings" "golang.org/x/mod/module" + "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/gopathwalk" ) @@ -37,7 +38,7 @@ type ModuleResolver struct { mains []*gocommand.ModuleJSON mainByDir map[string]*gocommand.ModuleJSON modsByModPath []*gocommand.ModuleJSON // All modules, ordered by # of path components in module Path... - modsByDir []*gocommand.ModuleJSON // ...or Dir. + modsByDir []*gocommand.ModuleJSON // ...or number of path components in their Dir. // moduleCacheCache stores information about the module cache. moduleCacheCache *dirInfoCache @@ -123,7 +124,7 @@ func (r *ModuleResolver) init() error { }) sort.Slice(r.modsByDir, func(i, j int) bool { count := func(x int) int { - return strings.Count(r.modsByDir[x].Dir, "/") + return strings.Count(r.modsByDir[x].Dir, string(filepath.Separator)) } return count(j) < count(i) // descending order }) @@ -327,6 +328,10 @@ func (r *ModuleResolver) findModuleByDir(dir string) *gocommand.ModuleJSON { // - in /vendor/ in -mod=vendor mode. // - nested module? Dunno. // Rumor has it that replace targets cannot contain other replace targets. + // + // Note that it is critical here that modsByDir is sorted to have deeper dirs + // first. This ensures that findModuleByDir finds the innermost module. + // See also golang/go#56291. for _, m := range r.modsByDir { if !strings.HasPrefix(dir, m.Dir) { continue @@ -424,6 +429,9 @@ func (r *ModuleResolver) loadPackageNames(importPaths []string, srcDir string) ( } func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error { + ctx, done := event.Start(ctx, "imports.ModuleResolver.scan") + defer done() + if err := r.init(); err != nil { return err } diff --git a/vendor/golang.org/x/tools/internal/imports/mod_cache.go b/vendor/golang.org/x/tools/internal/imports/mod_cache.go index 18dada4..45690ab 100644 --- a/vendor/golang.org/x/tools/internal/imports/mod_cache.go +++ b/vendor/golang.org/x/tools/internal/imports/mod_cache.go @@ -12,7 +12,7 @@ import ( "golang.org/x/tools/internal/gopathwalk" ) -// To find packages to import, the resolver needs to know about all of the +// To find packages to import, the resolver needs to know about all of // the packages that could be imported. This includes packages that are // already in modules that are in (1) the current module, (2) replace targets, // and (3) packages in the module cache. Packages in (1) and (2) may change over diff --git a/vendor/golang.org/x/tools/internal/imports/zstdlib.go b/vendor/golang.org/x/tools/internal/imports/zstdlib.go index 31a7594..9f992c2 100644 --- a/vendor/golang.org/x/tools/internal/imports/zstdlib.go +++ b/vendor/golang.org/x/tools/internal/imports/zstdlib.go @@ -93,6 +93,7 @@ var stdlib = map[string][]string{ "Compare", "Contains", "ContainsAny", + "ContainsFunc", "ContainsRune", "Count", "Cut", @@ -147,6 +148,11 @@ var stdlib = map[string][]string{ "TrimSpace", "TrimSuffix", }, + "cmp": { + "Compare", + "Less", + "Ordered", + }, "compress/bzip2": { "NewReader", "StructuralError", @@ -228,6 +234,7 @@ var stdlib = map[string][]string{ "Ring", }, "context": { + "AfterFunc", "Background", "CancelCauseFunc", "CancelFunc", @@ -239,8 +246,11 @@ var stdlib = map[string][]string{ "WithCancel", "WithCancelCause", "WithDeadline", + "WithDeadlineCause", "WithTimeout", + "WithTimeoutCause", "WithValue", + "WithoutCancel", }, "crypto": { "BLAKE2b_256", @@ -445,6 +455,7 @@ var stdlib = map[string][]string{ "XORBytes", }, "crypto/tls": { + "AlertError", "Certificate", "CertificateRequestInfo", "CertificateVerificationError", @@ -476,6 +487,7 @@ var stdlib = map[string][]string{ "LoadX509KeyPair", "NewLRUClientSessionCache", "NewListener", + "NewResumptionState", "NoClientCert", "PKCS1WithSHA1", "PKCS1WithSHA256", @@ -484,6 +496,27 @@ var stdlib = map[string][]string{ "PSSWithSHA256", "PSSWithSHA384", "PSSWithSHA512", + "ParseSessionState", + "QUICClient", + "QUICConfig", + "QUICConn", + "QUICEncryptionLevel", + "QUICEncryptionLevelApplication", + "QUICEncryptionLevelEarly", + "QUICEncryptionLevelHandshake", + "QUICEncryptionLevelInitial", + "QUICEvent", + "QUICEventKind", + "QUICHandshakeDone", + "QUICNoEvent", + "QUICRejectedEarlyData", + "QUICServer", + "QUICSessionTicketOptions", + "QUICSetReadSecret", + "QUICSetWriteSecret", + "QUICTransportParameters", + "QUICTransportParametersRequired", + "QUICWriteData", "RecordHeaderError", "RenegotiateFreelyAsClient", "RenegotiateNever", @@ -493,6 +526,7 @@ var stdlib = map[string][]string{ "RequireAndVerifyClientCert", "RequireAnyClientCert", "Server", + "SessionState", "SignatureScheme", "TLS_AES_128_GCM_SHA256", "TLS_AES_256_GCM_SHA384", @@ -523,6 +557,7 @@ var stdlib = map[string][]string{ "TLS_RSA_WITH_AES_256_GCM_SHA384", "TLS_RSA_WITH_RC4_128_SHA", "VerifyClientCertIfGiven", + "VersionName", "VersionSSL30", "VersionTLS10", "VersionTLS11", @@ -618,6 +653,7 @@ var stdlib = map[string][]string{ "PureEd25519", "RSA", "RevocationList", + "RevocationListEntry", "SHA1WithRSA", "SHA256WithRSA", "SHA256WithRSAPSS", @@ -1002,10 +1038,42 @@ var stdlib = map[string][]string{ "COMPRESS_LOOS", "COMPRESS_LOPROC", "COMPRESS_ZLIB", + "COMPRESS_ZSTD", "Chdr32", "Chdr64", "Class", "CompressionType", + "DF_1_CONFALT", + "DF_1_DIRECT", + "DF_1_DISPRELDNE", + "DF_1_DISPRELPND", + "DF_1_EDITED", + "DF_1_ENDFILTEE", + "DF_1_GLOBAL", + "DF_1_GLOBAUDIT", + "DF_1_GROUP", + "DF_1_IGNMULDEF", + "DF_1_INITFIRST", + "DF_1_INTERPOSE", + "DF_1_KMOD", + "DF_1_LOADFLTR", + "DF_1_NOCOMMON", + "DF_1_NODEFLIB", + "DF_1_NODELETE", + "DF_1_NODIRECT", + "DF_1_NODUMP", + "DF_1_NOHDR", + "DF_1_NOKSYMS", + "DF_1_NOOPEN", + "DF_1_NORELOC", + "DF_1_NOW", + "DF_1_ORIGIN", + "DF_1_PIE", + "DF_1_SINGLETON", + "DF_1_STUB", + "DF_1_SYMINTPOSE", + "DF_1_TRANS", + "DF_1_WEAKFILTER", "DF_BIND_NOW", "DF_ORIGIN", "DF_STATIC_TLS", @@ -1144,6 +1212,7 @@ var stdlib = map[string][]string{ "Dyn32", "Dyn64", "DynFlag", + "DynFlag1", "DynTag", "EI_ABIVERSION", "EI_CLASS", @@ -2111,6 +2180,7 @@ var stdlib = map[string][]string{ "R_PPC64_REL16_LO", "R_PPC64_REL24", "R_PPC64_REL24_NOTOC", + "R_PPC64_REL24_P9NOTOC", "R_PPC64_REL30", "R_PPC64_REL32", "R_PPC64_REL64", @@ -2848,6 +2918,7 @@ var stdlib = map[string][]string{ "MaxVarintLen16", "MaxVarintLen32", "MaxVarintLen64", + "NativeEndian", "PutUvarint", "PutVarint", "Read", @@ -2963,6 +3034,7 @@ var stdlib = map[string][]string{ }, "errors": { "As", + "ErrUnsupported", "Is", "Join", "New", @@ -2989,6 +3061,7 @@ var stdlib = map[string][]string{ "Arg", "Args", "Bool", + "BoolFunc", "BoolVar", "CommandLine", "ContinueOnError", @@ -3119,6 +3192,7 @@ var stdlib = map[string][]string{ "Inspect", "InterfaceType", "IsExported", + "IsGenerated", "KeyValueExpr", "LabeledStmt", "Lbl", @@ -3169,6 +3243,7 @@ var stdlib = map[string][]string{ "ArchChar", "Context", "Default", + "Directive", "FindOnly", "IgnoreVendor", "Import", @@ -3184,6 +3259,7 @@ var stdlib = map[string][]string{ "go/build/constraint": { "AndExpr", "Expr", + "GoVersion", "IsGoBuild", "IsPlusBuild", "NotExpr", @@ -3626,6 +3702,7 @@ var stdlib = map[string][]string{ "ErrBadHTML", "ErrBranchEnd", "ErrEndContext", + "ErrJSTemplate", "ErrNoSuchTemplate", "ErrOutputContext", "ErrPartialCharset", @@ -3870,6 +3947,8 @@ var stdlib = map[string][]string{ "FileInfo", "FileInfoToDirEntry", "FileMode", + "FormatDirEntry", + "FormatFileInfo", "Glob", "GlobFS", "ModeAppend", @@ -3942,6 +4021,78 @@ var stdlib = map[string][]string{ "SetPrefix", "Writer", }, + "log/slog": { + "Any", + "AnyValue", + "Attr", + "Bool", + "BoolValue", + "Debug", + "DebugContext", + "Default", + "Duration", + "DurationValue", + "Error", + "ErrorContext", + "Float64", + "Float64Value", + "Group", + "GroupValue", + "Handler", + "HandlerOptions", + "Info", + "InfoContext", + "Int", + "Int64", + "Int64Value", + "IntValue", + "JSONHandler", + "Kind", + "KindAny", + "KindBool", + "KindDuration", + "KindFloat64", + "KindGroup", + "KindInt64", + "KindLogValuer", + "KindString", + "KindTime", + "KindUint64", + "Level", + "LevelDebug", + "LevelError", + "LevelInfo", + "LevelKey", + "LevelVar", + "LevelWarn", + "Leveler", + "Log", + "LogAttrs", + "LogValuer", + "Logger", + "MessageKey", + "New", + "NewJSONHandler", + "NewLogLogger", + "NewRecord", + "NewTextHandler", + "Record", + "SetDefault", + "Source", + "SourceKey", + "String", + "StringValue", + "TextHandler", + "Time", + "TimeKey", + "TimeValue", + "Uint64", + "Uint64Value", + "Value", + "Warn", + "WarnContext", + "With", + }, "log/syslog": { "Dial", "LOG_ALERT", @@ -3977,6 +4128,13 @@ var stdlib = map[string][]string{ "Priority", "Writer", }, + "maps": { + "Clone", + "Copy", + "DeleteFunc", + "Equal", + "EqualFunc", + }, "math": { "Abs", "Acos", @@ -4371,6 +4529,7 @@ var stdlib = map[string][]string{ "ErrNoLocation", "ErrNotMultipart", "ErrNotSupported", + "ErrSchemeMismatch", "ErrServerClosed", "ErrShortBody", "ErrSkipAltProtocol", @@ -5084,6 +5243,8 @@ var stdlib = map[string][]string{ "NumCPU", "NumCgoCall", "NumGoroutine", + "PanicNilError", + "Pinner", "ReadMemStats", "ReadTrace", "SetBlockProfileRate", @@ -5172,6 +5333,37 @@ var stdlib = map[string][]string{ "Task", "WithRegion", }, + "slices": { + "BinarySearch", + "BinarySearchFunc", + "Clip", + "Clone", + "Compact", + "CompactFunc", + "Compare", + "CompareFunc", + "Contains", + "ContainsFunc", + "Delete", + "DeleteFunc", + "Equal", + "EqualFunc", + "Grow", + "Index", + "IndexFunc", + "Insert", + "IsSorted", + "IsSortedFunc", + "Max", + "MaxFunc", + "Min", + "MinFunc", + "Replace", + "Reverse", + "Sort", + "SortFunc", + "SortStableFunc", + }, "sort": { "Find", "Float64Slice", @@ -5242,6 +5434,7 @@ var stdlib = map[string][]string{ "Compare", "Contains", "ContainsAny", + "ContainsFunc", "ContainsRune", "Count", "Cut", @@ -5299,6 +5492,9 @@ var stdlib = map[string][]string{ "Mutex", "NewCond", "Once", + "OnceFunc", + "OnceValue", + "OnceValues", "Pool", "RWMutex", "WaitGroup", @@ -9135,10 +9331,12 @@ var stdlib = map[string][]string{ "SYS_AIO_CANCEL", "SYS_AIO_ERROR", "SYS_AIO_FSYNC", + "SYS_AIO_MLOCK", "SYS_AIO_READ", "SYS_AIO_RETURN", "SYS_AIO_SUSPEND", "SYS_AIO_SUSPEND_NOCANCEL", + "SYS_AIO_WAITCOMPLETE", "SYS_AIO_WRITE", "SYS_ALARM", "SYS_ARCH_PRCTL", @@ -9368,6 +9566,7 @@ var stdlib = map[string][]string{ "SYS_GET_MEMPOLICY", "SYS_GET_ROBUST_LIST", "SYS_GET_THREAD_AREA", + "SYS_GSSD_SYSCALL", "SYS_GTTY", "SYS_IDENTITYSVC", "SYS_IDLE", @@ -9411,8 +9610,24 @@ var stdlib = map[string][]string{ "SYS_KLDSYM", "SYS_KLDUNLOAD", "SYS_KLDUNLOADF", + "SYS_KMQ_NOTIFY", + "SYS_KMQ_OPEN", + "SYS_KMQ_SETATTR", + "SYS_KMQ_TIMEDRECEIVE", + "SYS_KMQ_TIMEDSEND", + "SYS_KMQ_UNLINK", "SYS_KQUEUE", "SYS_KQUEUE1", + "SYS_KSEM_CLOSE", + "SYS_KSEM_DESTROY", + "SYS_KSEM_GETVALUE", + "SYS_KSEM_INIT", + "SYS_KSEM_OPEN", + "SYS_KSEM_POST", + "SYS_KSEM_TIMEDWAIT", + "SYS_KSEM_TRYWAIT", + "SYS_KSEM_UNLINK", + "SYS_KSEM_WAIT", "SYS_KTIMER_CREATE", "SYS_KTIMER_DELETE", "SYS_KTIMER_GETOVERRUN", @@ -9504,11 +9719,14 @@ var stdlib = map[string][]string{ "SYS_NFSSVC", "SYS_NFSTAT", "SYS_NICE", + "SYS_NLM_SYSCALL", "SYS_NLSTAT", "SYS_NMOUNT", "SYS_NSTAT", "SYS_NTP_ADJTIME", "SYS_NTP_GETTIME", + "SYS_NUMA_GETAFFINITY", + "SYS_NUMA_SETAFFINITY", "SYS_OABI_SYSCALL_BASE", "SYS_OBREAK", "SYS_OLDFSTAT", @@ -9891,6 +10109,7 @@ var stdlib = map[string][]string{ "SYS___ACL_SET_FD", "SYS___ACL_SET_FILE", "SYS___ACL_SET_LINK", + "SYS___CAP_RIGHTS_GET", "SYS___CLONE", "SYS___DISABLE_THREADSIGNAL", "SYS___GETCWD", @@ -10574,6 +10793,7 @@ var stdlib = map[string][]string{ "Short", "T", "TB", + "Testing", "Verbose", }, "testing/fstest": { @@ -10603,6 +10823,9 @@ var stdlib = map[string][]string{ "SetupError", "Value", }, + "testing/slogtest": { + "TestHandler", + }, "text/scanner": { "Char", "Comment", @@ -10826,6 +11049,7 @@ var stdlib = map[string][]string{ "Cs", "Cuneiform", "Cypriot", + "Cypro_Minoan", "Cyrillic", "Dash", "Deprecated", @@ -10889,6 +11113,7 @@ var stdlib = map[string][]string{ "Kaithi", "Kannada", "Katakana", + "Kawi", "Kayah_Li", "Kharoshthi", "Khitan_Small_Script", @@ -10943,6 +11168,7 @@ var stdlib = map[string][]string{ "Myanmar", "N", "Nabataean", + "Nag_Mundari", "Nandinagari", "Nd", "New_Tai_Lue", @@ -10964,6 +11190,7 @@ var stdlib = map[string][]string{ "Old_Sogdian", "Old_South_Arabian", "Old_Turkic", + "Old_Uyghur", "Oriya", "Osage", "Osmanya", @@ -11038,6 +11265,7 @@ var stdlib = map[string][]string{ "Tai_Viet", "Takri", "Tamil", + "Tangsa", "Tangut", "Telugu", "Terminal_Punctuation", @@ -11052,6 +11280,7 @@ var stdlib = map[string][]string{ "ToLower", "ToTitle", "ToUpper", + "Toto", "TurkishCase", "Ugaritic", "Unified_Ideograph", @@ -11061,6 +11290,7 @@ var stdlib = map[string][]string{ "Vai", "Variation_Selector", "Version", + "Vithkuqi", "Wancho", "Warang_Citi", "White_Space", diff --git a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go index a3fb2d4..7e638ec 100644 --- a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go +++ b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go @@ -7,7 +7,9 @@ package tokeninternal import ( + "fmt" "go/token" + "sort" "sync" "unsafe" ) @@ -57,3 +59,93 @@ func GetLines(file *token.File) []int { panic("unexpected token.File size") } } + +// AddExistingFiles adds the specified files to the FileSet if they +// are not already present. It panics if any pair of files in the +// resulting FileSet would overlap. +func AddExistingFiles(fset *token.FileSet, files []*token.File) { + // Punch through the FileSet encapsulation. + type tokenFileSet struct { + // This type remained essentially consistent from go1.16 to go1.21. + mutex sync.RWMutex + base int + files []*token.File + _ *token.File // changed to atomic.Pointer[token.File] in go1.19 + } + + // If the size of token.FileSet changes, this will fail to compile. + const delta = int64(unsafe.Sizeof(tokenFileSet{})) - int64(unsafe.Sizeof(token.FileSet{})) + var _ [-delta * delta]int + + type uP = unsafe.Pointer + var ptr *tokenFileSet + *(*uP)(uP(&ptr)) = uP(fset) + ptr.mutex.Lock() + defer ptr.mutex.Unlock() + + // Merge and sort. + newFiles := append(ptr.files, files...) + sort.Slice(newFiles, func(i, j int) bool { + return newFiles[i].Base() < newFiles[j].Base() + }) + + // Reject overlapping files. + // Discard adjacent identical files. + out := newFiles[:0] + for i, file := range newFiles { + if i > 0 { + prev := newFiles[i-1] + if file == prev { + continue + } + if prev.Base()+prev.Size()+1 > file.Base() { + panic(fmt.Sprintf("file %s (%d-%d) overlaps with file %s (%d-%d)", + prev.Name(), prev.Base(), prev.Base()+prev.Size(), + file.Name(), file.Base(), file.Base()+file.Size())) + } + } + out = append(out, file) + } + newFiles = out + + ptr.files = newFiles + + // Advance FileSet.Base(). + if len(newFiles) > 0 { + last := newFiles[len(newFiles)-1] + newBase := last.Base() + last.Size() + 1 + if ptr.base < newBase { + ptr.base = newBase + } + } +} + +// FileSetFor returns a new FileSet containing a sequence of new Files with +// the same base, size, and line as the input files, for use in APIs that +// require a FileSet. +// +// Precondition: the input files must be non-overlapping, and sorted in order +// of their Base. +func FileSetFor(files ...*token.File) *token.FileSet { + fset := token.NewFileSet() + for _, f := range files { + f2 := fset.AddFile(f.Name(), f.Base(), f.Size()) + lines := GetLines(f) + f2.SetLines(lines) + } + return fset +} + +// CloneFileSet creates a new FileSet holding all files in fset. It does not +// create copies of the token.Files in fset: they are added to the resulting +// FileSet unmodified. +func CloneFileSet(fset *token.FileSet) *token.FileSet { + var files []*token.File + fset.Iterate(func(f *token.File) bool { + files = append(files, f) + return true + }) + newFileSet := token.NewFileSet() + AddExistingFiles(newFileSet, files) + return newFileSet +} diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go index 25a1426..d0d0649 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/common.go +++ b/vendor/golang.org/x/tools/internal/typeparams/common.go @@ -23,6 +23,7 @@ package typeparams import ( + "fmt" "go/ast" "go/token" "go/types" @@ -87,7 +88,6 @@ func IsTypeParam(t types.Type) bool { func OriginMethod(fn *types.Func) *types.Func { recv := fn.Type().(*types.Signature).Recv() if recv == nil { - return fn } base := recv.Type() @@ -106,6 +106,31 @@ func OriginMethod(fn *types.Func) *types.Func { } orig := NamedTypeOrigin(named) gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name()) + + // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In: + // package p + // type T *int + // func (*T) f() {} + // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}. + // Here we make them consistent by force. + // (The go/types bug is general, but this workaround is reached only + // for generic T thanks to the early return above.) + if gfn == nil { + mset := types.NewMethodSet(types.NewPointer(orig)) + for i := 0; i < mset.Len(); i++ { + m := mset.At(i) + if m.Obj().Id() == fn.Id() { + gfn = m.Obj() + break + } + } + } + + // In golang/go#61196, we observe another crash, this time inexplicable. + if gfn == nil { + panic(fmt.Sprintf("missing origin method for %s.%s; named == origin: %t, named.NumMethods(): %d, origin.NumMethods(): %d", named, fn, named == orig, named.NumMethods(), orig.NumMethods())) + } + return gfn.(*types.Func) } diff --git a/vendor/golang.org/x/tools/internal/typeparams/coretype.go b/vendor/golang.org/x/tools/internal/typeparams/coretype.go index 993135e..7124820 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/coretype.go +++ b/vendor/golang.org/x/tools/internal/typeparams/coretype.go @@ -81,13 +81,13 @@ func CoreType(T types.Type) types.Type { // restrictions may be arbitrarily complex. For example, consider the // following: // -// type A interface{ ~string|~[]byte } +// type A interface{ ~string|~[]byte } // -// type B interface{ int|string } +// type B interface{ int|string } // -// type C interface { ~string|~int } +// type C interface { ~string|~int } // -// type T[P interface{ A|B; C }] int +// type T[P interface{ A|B; C }] int // // In this example, the structural type restriction of P is ~string|int: A|B // expands to ~string|~[]byte|int|string, which reduces to ~string|~[]byte|int, diff --git a/vendor/golang.org/x/tools/internal/typeparams/termlist.go b/vendor/golang.org/x/tools/internal/typeparams/termlist.go index 933106a..cbd12f8 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/termlist.go +++ b/vendor/golang.org/x/tools/internal/typeparams/termlist.go @@ -30,7 +30,7 @@ func (xl termlist) String() string { var buf bytes.Buffer for i, x := range xl { if i > 0 { - buf.WriteString(" ∪ ") + buf.WriteString(" | ") } buf.WriteString(x.String()) } diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go index b478897..7ed86e1 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go +++ b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go @@ -129,7 +129,7 @@ func NamedTypeArgs(*types.Named) *TypeList { } // NamedTypeOrigin is the identity method at this Go version. -func NamedTypeOrigin(named *types.Named) types.Type { +func NamedTypeOrigin(named *types.Named) *types.Named { return named } diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go index 114a36b..cf301af 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go +++ b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go @@ -103,7 +103,7 @@ func NamedTypeArgs(named *types.Named) *TypeList { } // NamedTypeOrigin returns named.Orig(). -func NamedTypeOrigin(named *types.Named) types.Type { +func NamedTypeOrigin(named *types.Named) *types.Named { return named.Origin() } diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeterm.go b/vendor/golang.org/x/tools/internal/typeparams/typeterm.go index 7ddee28..7350bb7 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/typeterm.go +++ b/vendor/golang.org/x/tools/internal/typeparams/typeterm.go @@ -10,11 +10,10 @@ import "go/types" // A term describes elementary type sets: // -// ∅: (*term)(nil) == ∅ // set of no types (empty set) -// 𝓤: &term{} == 𝓤 // set of all types (𝓤niverse) -// T: &term{false, T} == {T} // set of type T -// ~t: &term{true, t} == {t' | under(t') == t} // set of types with underlying type t -// +// ∅: (*term)(nil) == ∅ // set of no types (empty set) +// 𝓤: &term{} == 𝓤 // set of all types (𝓤niverse) +// T: &term{false, T} == {T} // set of type T +// ~t: &term{true, t} == {t' | under(t') == t} // set of types with underlying type t type term struct { tilde bool // valid if typ != nil typ types.Type diff --git a/vendor/golang.org/x/tools/internal/typesinternal/objectpath.go b/vendor/golang.org/x/tools/internal/typesinternal/objectpath.go new file mode 100644 index 0000000..5e96e89 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/typesinternal/objectpath.go @@ -0,0 +1,24 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package typesinternal + +import "go/types" + +// This file contains back doors that allow gopls to avoid method sorting when +// using the objectpath package. +// +// This is performance-critical in certain repositories, but changing the +// behavior of the objectpath package is still being discussed in +// golang/go#61443. If we decide to remove the sorting in objectpath we can +// simply delete these back doors. Otherwise, we should add a new API to +// objectpath that allows controlling the sorting. + +// SkipEncoderMethodSorting marks enc (which must be an *objectpath.Encoder) as +// not requiring sorted methods. +var SkipEncoderMethodSorting func(enc interface{}) + +// ObjectpathObject is like objectpath.Object, but allows suppressing method +// sorting. +var ObjectpathObject func(pkg *types.Package, p string, skipMethodSorting bool) (types.Object, error) diff --git a/vendor/modules.txt b/vendor/modules.txt index 9dc3b24..80caa6c 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -8,7 +8,7 @@ github.com/alecthomas/template/parse # github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 ## explicit; go 1.15 github.com/alecthomas/units -# github.com/armon/go-metrics v0.3.10 +# github.com/armon/go-metrics v0.5.1 => github.com/hashicorp/go-metrics v0.4.1 ## explicit; go 1.12 github.com/armon/go-metrics # github.com/beorn7/perks v1.0.1 @@ -17,14 +17,14 @@ github.com/beorn7/perks/quantile # github.com/cespare/xxhash/v2 v2.2.0 ## explicit; go 1.11 github.com/cespare/xxhash/v2 -# github.com/fatih/color v1.9.0 -## explicit; go 1.13 +# github.com/fatih/color v1.15.0 +## explicit; go 1.17 github.com/fatih/color -# github.com/felixge/httpsnoop v1.0.2 +# github.com/felixge/httpsnoop v1.0.3 ## explicit; go 1.13 github.com/felixge/httpsnoop -# github.com/fsnotify/fsnotify v1.4.9 -## explicit; go 1.13 +# github.com/fsnotify/fsnotify v1.6.0 +## explicit; go 1.16 github.com/fsnotify/fsnotify # github.com/golang/protobuf v1.5.3 ## explicit; go 1.9 @@ -42,32 +42,32 @@ github.com/gorilla/handlers # github.com/gorilla/mux v1.8.0 ## explicit; go 1.12 github.com/gorilla/mux -# github.com/hashicorp/consul/api v1.21.0 +# github.com/hashicorp/consul/api v1.25.1 ## explicit; go 1.19 github.com/hashicorp/consul/api -# github.com/hashicorp/go-cleanhttp v0.5.1 -## explicit +# github.com/hashicorp/go-cleanhttp v0.5.2 +## explicit; go 1.13 github.com/hashicorp/go-cleanhttp -# github.com/hashicorp/go-hclog v0.14.1 +# github.com/hashicorp/go-hclog v1.5.0 ## explicit; go 1.13 github.com/hashicorp/go-hclog -# github.com/hashicorp/go-immutable-radix v1.3.0 +# github.com/hashicorp/go-immutable-radix v1.3.1 ## explicit github.com/hashicorp/go-immutable-radix # github.com/hashicorp/go-rootcerts v1.0.2 ## explicit; go 1.12 github.com/hashicorp/go-rootcerts -# github.com/hashicorp/golang-lru v0.5.4 +# github.com/hashicorp/golang-lru v1.0.2 ## explicit; go 1.12 github.com/hashicorp/golang-lru/simplelru # github.com/hashicorp/serf v0.10.1 ## explicit; go 1.12 github.com/hashicorp/serf/coordinate -# github.com/mattn/go-colorable v0.1.6 -## explicit; go 1.13 +# github.com/mattn/go-colorable v0.1.13 +## explicit; go 1.15 github.com/mattn/go-colorable -# github.com/mattn/go-isatty v0.0.12 -## explicit; go 1.12 +# github.com/mattn/go-isatty v0.0.19 +## explicit; go 1.15 github.com/mattn/go-isatty # github.com/matttproud/golang_protobuf_extensions v1.0.4 ## explicit; go 1.9 @@ -81,7 +81,7 @@ github.com/maxbrunsfeld/counterfeiter/v6/generator # github.com/mitchellh/go-homedir v1.1.0 ## explicit github.com/mitchellh/go-homedir -# github.com/mitchellh/mapstructure v1.4.1 +# github.com/mitchellh/mapstructure v1.5.0 ## explicit; go 1.14 github.com/mitchellh/mapstructure # github.com/nxadm/tail v1.4.8 @@ -113,7 +113,7 @@ github.com/onsi/ginkgo/reporters/stenographer github.com/onsi/ginkgo/reporters/stenographer/support/go-colorable github.com/onsi/ginkgo/reporters/stenographer/support/go-isatty github.com/onsi/ginkgo/types -# github.com/onsi/gomega v1.22.1 +# github.com/onsi/gomega v1.27.10 ## explicit; go 1.18 github.com/onsi/gomega github.com/onsi/gomega/format @@ -143,7 +143,7 @@ github.com/prometheus/common/expfmt github.com/prometheus/common/internal/bitbucket.org/ww/goautoneg github.com/prometheus/common/model github.com/prometheus/common/version -# github.com/prometheus/procfs v0.11.1 +# github.com/prometheus/procfs v0.12.0 ## explicit; go 1.19 github.com/prometheus/procfs github.com/prometheus/procfs/internal/fs @@ -154,23 +154,27 @@ github.com/russross/blackfriday/v2 # github.com/sirupsen/logrus v1.9.3 ## explicit; go 1.13 github.com/sirupsen/logrus -# golang.org/x/mod v0.8.0 +# golang.org/x/exp v0.0.0-20230905200255-921286631fa9 +## explicit; go 1.20 +golang.org/x/exp/constraints +golang.org/x/exp/slices +# golang.org/x/mod v0.12.0 ## explicit; go 1.17 golang.org/x/mod/internal/lazyregexp golang.org/x/mod/module golang.org/x/mod/semver -# golang.org/x/net v0.10.0 +# golang.org/x/net v0.15.0 ## explicit; go 1.17 golang.org/x/net/html golang.org/x/net/html/atom golang.org/x/net/html/charset -# golang.org/x/sys v0.11.0 +# golang.org/x/sys v0.12.0 ## explicit; go 1.17 golang.org/x/sys/execabs golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.9.0 +# golang.org/x/text v0.13.0 ## explicit; go 1.17 golang.org/x/text/encoding golang.org/x/text/encoding/charmap @@ -189,18 +193,20 @@ golang.org/x/text/internal/utf8internal golang.org/x/text/language golang.org/x/text/runes golang.org/x/text/transform -# golang.org/x/tools v0.6.0 +# golang.org/x/tools v0.13.0 ## explicit; go 1.18 golang.org/x/tools/go/ast/astutil golang.org/x/tools/go/gcexportdata golang.org/x/tools/go/internal/packagesdriver golang.org/x/tools/go/packages +golang.org/x/tools/go/types/objectpath golang.org/x/tools/go/types/typeutil golang.org/x/tools/imports golang.org/x/tools/internal/event golang.org/x/tools/internal/event/core golang.org/x/tools/internal/event/keys golang.org/x/tools/internal/event/label +golang.org/x/tools/internal/event/tag golang.org/x/tools/internal/fastwalk golang.org/x/tools/internal/gcimporter golang.org/x/tools/internal/gocommand @@ -250,3 +256,4 @@ gopkg.in/yaml.v2 # gopkg.in/yaml.v3 v3.0.1 ## explicit gopkg.in/yaml.v3 +# github.com/armon/go-metrics => github.com/hashicorp/go-metrics v0.4.1