forked from nf-core/modules
-
Notifications
You must be signed in to change notification settings - Fork 0
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Update module: bakta/bakta (nf-core#4847)
* Add nf-test + remove pytest files * Apply changes from code review * Fix main.test.nf * Update process label to increase memory/fix diamond error * Stub tests only * Increase memory (for CI checks to succeed) * Fix config, activate test * Increase memory * Increase memory * Activate singularity profile * Exclude conda tests due to DIAMOND memory issue on conda * Skip conda * Skip conda CI check of dependency baktadbdownload --------- Co-authored-by: James A. Fellows Yates <[email protected]>
- Loading branch information
1 parent
72c1733
commit fec1ac8
Showing
15 changed files
with
283 additions
and
67 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
|
@@ -4,4 +4,4 @@ channels: | |
- bioconda | ||
- defaults | ||
dependencies: | ||
- bioconda::bakta=1.8.2 | ||
- bioconda::bakta=1.9.2 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,83 @@ | ||
nextflow_process { | ||
|
||
name "Test Process BAKTA_BAKTA" | ||
script "../main.nf" | ||
config "./nextflow.config" | ||
process "BAKTA_BAKTA" | ||
|
||
tag "modules" | ||
tag "modules_nfcore" | ||
tag "bakta" | ||
tag "bakta/bakta" | ||
tag "bakta/baktadbdownload" | ||
|
||
test("Bakta - bacteroides_fragilis - genome.fasta") { | ||
|
||
setup { | ||
run("BAKTA_BAKTADBDOWNLOAD") { | ||
script "../../baktadbdownload/main.nf" | ||
process { | ||
""" | ||
""" | ||
} | ||
} | ||
} | ||
|
||
when { | ||
process { | ||
""" | ||
input[0] = [ | ||
[ id:'test', single_end:false ], // meta map | ||
file(params.test_data['bacteroides_fragilis']['illumina']['test1_contigs_fa_gz'], checkIfExists: true) | ||
] | ||
input[1] = BAKTA_BAKTADBDOWNLOAD.out.db | ||
input[2] = [] | ||
input[3] = [] | ||
""" | ||
} | ||
} | ||
|
||
then { | ||
assertAll( | ||
{ assert process.success }, | ||
{ assert path(process.out.embl.get(0).get(1)).text.contains("/translation=\"MKNTLKIAILLIAIISMGHWMPVKQVCDLNSLSLQNVEALANGET") }, | ||
{ assert path(process.out.faa.get(0).get(1)).text.contains("MKNTLKIAILLIAIISMGHWMPVKQVCDLNSLSLQNVEALANGETPNYTFCIGAGSVDCPIQHDKVKYVSQGFSLDY") }, | ||
{ assert path(process.out.ffn.get(0).get(1)).text.contains("ATGAAAAACACTTTAAAAATAGCTATTCTTCTTATTGCTATTATTTCTATGGGGCATTGGATGCCTGTAAAACAAGT") }, | ||
{ assert path(process.out.fna.get(0).get(1)).text.contains("TCTTTTTACTCATAATCTACTTTTATGATGTTAATTATTTTTTCCGTGTCTCTCTTTCGG") }, | ||
{ assert path(process.out.gbff.get(0).get(1)).text.contains("/translation=\"MKNTLKIAILLIAIISMGHWMPVKQVCDLNSLSLQNVEALANGET") }, | ||
{ assert path(process.out.gff.get(0).get(1)).text.contains("##sequence-region contig_1 1 2926") }, | ||
{ assert path(process.out.hypotheticals_tsv.get(0).get(1)).text.contains("#Annotated with Bakta") }, | ||
{ assert path(process.out.hypotheticals_faa.get(0).get(1)).text.contains("MKNLILVLGCFFFLISCQQTEKEKLEELVKNWNGKEVLL") }, | ||
{ assert path(process.out.tsv.get(0).get(1)).text.contains("SO:0001217, UniRef:UniRef50_A0A0I9S7A3") }, | ||
{ assert path(process.out.txt.get(0).get(1)).text.contains("Length: 1739120") }, | ||
{ assert snapshot(process.out.versions).match("versions") } | ||
) | ||
} | ||
|
||
} | ||
|
||
test("Bakta - stub") { | ||
|
||
options "-stub" | ||
|
||
when { | ||
process { | ||
""" | ||
input[0] = [[id: 'stub'],file('stub')] | ||
input[1] = [] | ||
input[2] = [] | ||
input[3] = [] | ||
""" | ||
} | ||
} | ||
|
||
then { | ||
assertAll( | ||
{ assert process.success }, | ||
{ assert snapshot(process.out).match() } | ||
) | ||
} | ||
|
||
} | ||
|
||
} |
Some generated files are not rendered by default. Learn more about how customized files appear on GitHub.
Oops, something went wrong.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,11 @@ | ||
process { | ||
|
||
withName: 'BAKTA_BAKTADBDOWNLOAD' { | ||
ext.args = "--type light" | ||
} | ||
|
||
withName: 'BAKTA_BAKTA' { | ||
memory = 15.4.GB | ||
} | ||
|
||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,2 @@ | ||
bakta/bakta: | ||
- "modules/nf-core/bakta/bakta/**" |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,7 +1,7 @@ | ||
process { | ||
|
||
|
||
withName: 'BAKTA_BAKTADBDOWNLOAD' { | ||
ext.args = "--type light" | ||
} | ||
|
||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file was deleted.
Oops, something went wrong.
This file was deleted.
Oops, something went wrong.
This file was deleted.
Oops, something went wrong.
This file was deleted.
Oops, something went wrong.
This file was deleted.
Oops, something went wrong.
This file was deleted.
Oops, something went wrong.