Skip to content

TravisWheelerLab/nail

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

nail workspace

About

This is a cargo workspace for nail, which is a profile Hidden Markov Model (pHMM) biological sequence alignment tool. Using the fast MMseqs2 search pipeline to produce candidate alignment seeds, nail computes a fast approximation of the HMMER3 Forward/Backward (F/B) sequence alignment algorithm. Currently, nail only supports amino acid search, with nucleotide search coming in a future update.

The nail preprint paper can be found on bioRxiv (doi: https://doi.org/10.1101/2024.01.27.577580).

What's here

There are two sub-projects in the nail workspace:

  1. nail: this is the command line tool
  2. libnail: this is a Rust library that contains the implementation of nail's sparse alignment algorithms

Example input files

A few example input files may be found under the fixtures/ directory at the root of this repository.

$ ls fixtures/
query.fa  target.fa  query.hmm

Dependencies

The nail search pipeline uses the mmseqs search tool as an alignment prefilter. In the future, we will replace this with our own prefiltering strategies.

nail has been tested with MMseqs2 Release 15-6f452. We have not tested nail against other versions of MMseqs2, but they may work.

To run the nail search pipeline, mmseqs search must be available in your system path.

Installation

To install nail, you'll need the Rust development tooling, which means you'll need to install the Rust compiler and Cargo. The easiest way to do that is to use rustup.

Once Cargo is installed, you can install nail with:

cargo install nail

Building from source

If you'd like to build nail from source, you can clone this repository and build the project with Cargo:

git clone https://github.com/TravisWheelerLab/nail
cd nail/
cargo build --release

You'll then find the compiled binary at: target/release/nail

For example, try running:

target/release/nail -h

Usage

The nail command line interface has two subcommands: search and seed.

nail search

The nail search command runs the entire nail pipeline, including running MMseqs2 to find alignment seeds.

The input to nail search is a query file (p7HMM or FASTA) and a target sequence database file (FASTA).

By default, the search results will be written to ./results.tbl in a tabular format, and alignment output is written to stdout. In addition, a collection of temporary files required to run mmseqs search, will be written to the ./prep/ directory.

For example, when running nail search, you'll see something like:

$ nail search query.hmm target.fa

==  score: 257.1 bits;  E-value: 9.7e-79
                              7tm_1     2 NllVilvilrnkklrtptnifllnLavaDllvlllvlpfslvyallegdwvfgevlCklvtaldvvnltasillltaisi 81   
                                          N +Vi++++r++kl+tp+n+++ +La++Dllv++lv+p+s++y++ +g+w++g++lC+++ + d++++tasi++l++i++
O08892|reviewed|5-hydroxytryptamine    66 NAFVIATVYRTRKLHTPANYLIASLAFTDLLVSILVMPISTMYTV-TGRWTLGQALCDFWLSSDITCCTASIMHLCVIAL 145  
                                          9********************************************06*********************************

                              7tm_1    82 DRYlaIvkplkykrirtkrralvlilvvWvlalllslppllfsgtktesaekeetvClidfpeeestwevsytlllsvlg 161  
                                          DRY+aI+ ++ y+++rt+rra+ +i++vWv+++++slpp+++++ k e   +e+  Cl+++++      v yt++++ ++
O08892|reviewed|5-hydroxytryptamine   146 DRYWAITDAVGYSAKRTPRRAAGMIALVWVFSICISLPPFFWRQAKAE---EEVLDCLVNTDH------VLYTVYSTGGA 225  
                                          *****************************************777666500099******99990000009**********

                              7tm_1   162 fllpllvilvcyvrilrtlrksakkeks.................................................... 241  
                                          f+lp+l+++ +y ri+ ++r++  k++                                                     
O08892|reviewed|5-hydroxytryptamine   226 FYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQLITDSPGSTSSVTSINSRAPEVPCDSGSPVYVNQVKVRVSD 305  
                                          ***********************9999899999999999999999999********************************

                              7tm_1   242 ....rkkksarkerkalktllvvvvvfvlcwlPyfilllldsllkeceseklve.tallitlllayvnsclNPiiY 317  
                                              +kk +a++erka+ktl+v++++f++cwlP+fi++l++ +   c++ +  + ++++++++l+y+ns++NPiiY
O08892|reviewed|5-hydroxytryptamine   306 ALLEKKKLMAARERKATKTLGVILGAFIVCWLPFFIISLVMPI---CKDACWFHMAIFDFFTWLGYLNSLINPIIY 381  
                                      ***9999************************************000777666551666******************
...
...
...

Checking the results.tbl might look something like:

$ head -n 15 results.bl

#                                                                         target target query query       comp         cell  
# target                                                  query           start  end    start end   score bias evalue  frac  
# ------------------------------------------------------- --------------- ------ ------ ----- ----- ----- ---- ------- ----- 
F1MV99|reviewed|Somatostatin                              7tm_1-consensus 58     306    1     260   175.8 7.5  1.0e-53 0.066
O08858|reviewed|Somatostatin                              7tm_1-consensus 54     303    1     260   173.0 7.8  7.7e-53 0.069
C3ZQF9|reviewed|QRFP-like                                 7tm_1-consensus 64     326    1     260   149.3 8.6  1.3e-45 0.070
O02813|reviewed|Neuropeptide                              7tm_1-consensus 56     319    1     260   147.9 5.4  3.5e-45 0.070
O08565|reviewed|C-X-C                                     7tm_1-consensus 52     299    1     260   145.8 5.3  1.5e-44 0.076
O02835|reviewed|Neuropeptide                              7tm_1-consensus 57     320    1     260   145.7 6.8  1.6e-44 0.071
A0T2N3|reviewed|Apelin                                    7tm_1-consensus 51     316    1     260   145.0 4.3  2.6e-44 0.077
O08726|reviewed|Galanin                                   7tm_1-consensus 42     292    1     260   144.9 4.2  2.8e-44 0.073
O08556|reviewed|C-C                                       7tm_1-consensus 49     299    1     260   144.3 5.3  4.4e-44 0.073
F1R332|reviewed|Galanin                                   7tm_1-consensus 35     286    1     260   143.3 3.8  8.9e-44 0.077
D4A7K7|reviewed|G-protein                                 7tm_1-consensus 44     304    1     260   142.7 4.3  1.3e-43 0.073
E7F7V7|reviewed|Galanin                                   7tm_1-consensus 43     294    1     260   142.6 1.7  1.4e-43 0.073

nail seed

The nail seed command runs MMseqs2 and produces a seeds.json file.

For example:

$ nail seed query.hmm target.fa

Seeds can be provided to nail search using the --seeds <seeds.json> flag, which will skip the seed step in the search pipeline.

$ nail search --seeds seeds.json query.hmm target.fa

In practice, these seeds may be produced from any source as long as they are formatted in the following way:

{
  "query1": {
    "target1": {
      "target_start": 48,
      "target_end": 287,
      "profile_start": 1,
      "profile_end": 259,
      "score": 168.0
    },
    "target2": {
      "target_start": 72,
      "target_end": 343,
      "profile_start": 23,
      "profile_end": 259,
      "score": 106.0
    },
  "query2": {
    "target3": {
      "target_start": 56,
      "target_end": 303,
      "profile_start": 1,
      "profile_end": 259,
      "score": 125.0
    },
  }
  ...
}

License

nail is licensed under the BSD-3-Clause license.

See LICENSE for details.

Authors

Jack Roddy - [email protected]